Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK6PUYF)

• DOT Name: Multiple myeloma tumor-associated protein 2 (C1ORF35)
• Synonyms: hMMTAG2
• Gene Name: C1ORF35
• UniProt ID: MMTA2_HUMAN
• Pfam ID: PF10159
• Sequence:
  MFGSSRGGVRGGQDQFNWEDVKTDKQRENYLGNSLMAPVGRWQKGRDLTWYAKGRAPCAG
  PSREEELAAVREAEREALLAALGYKNVKKQPTGLSKEDFAEVCKREGGDPEEKGVDRLLG
  LGSASGSVGRVAMSREDKEAAKLGLSVFTHHRVESGGPGTSAASARRKPRAEDQTESSCE
  SHRKSKKEKKKKKKRKHKKEKKKKDKEHRRPAEATSSPTSPERPRHHHHDSDSNSPCCKR
  RKRGHSGDRRSPSRRWHDRGSEA
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Multiple myeloma tumor-associated protein 2 (C1ORF35).	[1]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Multiple myeloma tumor-associated protein 2 (C1ORF35).	[2]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Multiple myeloma tumor-associated protein 2 (C1ORF35).	[4]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Multiple myeloma tumor-associated protein 2 (C1ORF35).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Multiple myeloma tumor-associated protein 2 (C1ORF35).	[5]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Multiple myeloma tumor-associated protein 2 (C1ORF35).	[6]

References

• [1] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [2] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.