Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK9R50G)

• DOT Name: C-X-C chemokine receptor type 6 (CXCR6)
• Synonyms: CXC-R6; CXCR-6; CDw186; G-protein coupled receptor STRL33; G-protein coupled receptor bonzo; CD antigen CD186
• Gene Name: CXCR6
• UniProt ID: CXCR6_HUMAN
• Pfam ID: PF00001
• Sequence:
  MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH
  KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL
  TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC
  GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF
  LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
  KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
• Function: Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1.
• Tissue Specificity: Expressed in lymphoid tissues and activated T cells.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Chemokine sig.ling pathway (hsa04062)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	C-X-C chemokine receptor type 6 (CXCR6) decreases the response to substance of Paclitaxel.	[4]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of C-X-C chemokine receptor type 6 (CXCR6).	[1]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of C-X-C chemokine receptor type 6 (CXCR6).	[2]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of C-X-C chemokine receptor type 6 (CXCR6).	[3]

References

• [1] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [2] Altered expression of genes identified in rats with prostatic chronic inflammation in a prostate spheroid model treated by estradiol/testosterone. J Toxicol Sci. 2021;46(11):515-523. doi: 10.2131/jts.46.515.
• [3] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [4] cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.