Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKBSKEN)

• DOT Name: Protein CIMAP1C (CIMAP1C)
• Synonyms: Ciliary microtubule associated protein 1C; Outer dense fiber protein 3-like protein 1
• Gene Name: CIMAP1C
• UniProt ID: CMA1C_HUMAN
• Pfam ID: PF07004
• Sequence:
  MKLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSCTGYIDHDIS
  MFKAPAYTLHSRHSEKRMVCHSSPGPCYLLDPKITRFGMSSCPQVPMEERISNLRLNPTL
  ASCQYYFEKIHPPGERRAPQYTFGYRRPYRVMDLNPAPNQYQMPLLLGPNTPVSRAAPCY
  SLASRDKNWFYKEDVAGGPGPTTYARPEPSIYQNRSPTYSMAKRFAYPLDLTPRPGPGSH
  EVQQVTVHKPHIPAFTMGIKHSLHLCPLVIDIRD

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein CIMAP1C (CIMAP1C).	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein CIMAP1C (CIMAP1C).	[2]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Protein CIMAP1C (CIMAP1C).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Protein CIMAP1C (CIMAP1C).	[4]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [4] Effect of benzo[a]pyrene on proliferation and metastasis of oral squamous cell carcinoma cells: A transcriptome analysis based on RNA-seq. Environ Toxicol. 2022 Nov;37(11):2589-2604. doi: 10.1002/tox.23621. Epub 2022 Jul 23.