Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKH0NVX)

• DOT Name: Dehydrogenase/reductase SDR family member 4-like 2 (DHRS4L2)
• Synonyms: EC 1.1.-.-; Short chain dehydrogenase/reductase family 25C member 3; Protein SDR25C3
• Gene Name: DHRS4L2
• UniProt ID: DR4L2_HUMAN
• EC Number: 1.1.-.-
• Pfam ID: PF00106
• Sequence:
  MQMARLLGLCAWARKSVRMASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVV
  VSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVN
  PFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFS
  PYNVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA
• Function: Probable oxidoreductase.
• KEGG Pathway:
  Retinol metabolism (hsa00830)
  Metabolic pathways (hsa01100)

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Dehydrogenase/reductase SDR family member 4-like 2 (DHRS4L2).	[1]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Dehydrogenase/reductase SDR family member 4-like 2 (DHRS4L2).	[2]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Dehydrogenase/reductase SDR family member 4-like 2 (DHRS4L2).	[3]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Dehydrogenase/reductase SDR family member 4-like 2 (DHRS4L2).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Dehydrogenase/reductase SDR family member 4-like 2 (DHRS4L2).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Dehydrogenase/reductase SDR family member 4-like 2 (DHRS4L2).	[4]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [3] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.