Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKHIYYT)

• DOT Name: Visual pigment-like receptor peropsin (RRH)
• Gene Name: RRH
• Related Disease:
  Retinal degeneration
  Retinitis pigmentosa
  Urinary tract infection
• UniProt ID: OPSX_HUMAN
• Pfam ID: PF00001
• Sequence:
  MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIFIKYKELRTPT
  NAIIINLAVTDIGVSSIGYPMSAASDLYGSWKFGYAGCQVYAGLNIFFGMASIGLLTVVA
  VDRYLTICLPDVGRRMTTNTYIGLILGAWINGLFWALMPIIGWASYAPDPTGATCTINWR
  KNDRSFVSYTMTVIAINFIVPLTVMFYCYYHVTLSIKHHTTSDCTESLNRDWSDQIDVTK
  MSVIMICMFLVAWSPYSIVCLWASFGDPKKIPPPMAIIAPLFAKSSTFYNPCIYVVANKK
  FRRAMLAMFKCQTHQTMPVTSILPMDVSQNPLASGRI
• Function: May play a role in rpe physiology either by detecting light directly or by monitoring the concentration of retinoids or other photoreceptor-derived compounds.
• Tissue Specificity: Found only in the eye, where it is localized to the retinal pigment epithelium (RPE). In the RPE, it is localized to the microvilli that surround the photoreceptor outer segments.
• Reactome Pathway:
  Opsins (R-HSA-419771)
  G alpha (i) signalling events (R-HSA-418594)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Retinal degeneration	DISM1JHQ	Strong	Biomarker	[1]
Retinitis pigmentosa	DISCGPY8	Strong	Biomarker	[2]
Urinary tract infection	DISMT6UV	Strong	Biomarker	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Visual pigment-like receptor peropsin (RRH).	[4]

References

• [1] Mutation screening of the peropsin gene, a retinal pigment epithelium specific rhodopsin homolog, in patients with retinitis pigmentosa and allied diseases.Mol Vis. 2006 Dec 5;12:1511-5.
• [2] RRH, encoding the RPE-expressed opsin-like peropsin, is not mutated in retinitis pigmentosa and allied diseases.Ophthalmic Genet. 2007 Mar;28(1):31-7. doi: 10.1080/13816810701202052.
• [3] Comparative analysis of genitourinary function after type C1 robotic nerve-sparing radical hysterectomy versus type C2 robotic radical hysterectomy.Surg Oncol. 2019 Sep;30:58-62. doi: 10.1016/j.suronc.2019.05.003. Epub 2019 May 11.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.