Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKIK5HR)

DOT Name	Protein FRG2 (FRG2)
Synonyms	FSHD region gene 2 protein
Gene Name	FRG2
Related Disease	Crohn disease ( ) facioscapulohumeral muscular dystrophy ( )
UniProt ID	FRG2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15315
Sequence	MGKGNEDSDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKEKGKTAFSHSSEKHIQRQG SEPNPNKENSEETKLKAGNSTAGSEPESSSYRENCRKRKMSSKDSCQDTAGNCPEKECSL SLNKKSRSSTAVHNSEIQETCDAHHRGHSRACTGHSKRHRSRALGVQTPSIRKSLVTSVR AMSEAVYQDLAQVWAQQIHSPLTCEQLTLLTRLRGPLCAQVQTLYSMATQAAYVFPAESW LVPATLPGPGESALDREAHPFPGQEITETVSGSDEAKL
Tissue Specificity	Expression is undetectable in all tissues tested except for differentiating myoblasts of FSHD patients, which display low, yet distinct levels of expression, partly from FRG2, but predominantly originating from its homolog on chromosome 10.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Crohn disease	DIS2C5Q8	Strong	Genetic Variation	[1]
facioscapulohumeral muscular dystrophy	DISSE0H0	Strong	Altered Expression	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein FRG2 (FRG2).	[3]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Protein FRG2 (FRG2).	[5]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein FRG2 (FRG2).	[4]
------------------------------------------------------------------------------------

References

1	Cryptic 13q34 and 4q35.2 Deletions in an Italian Family.Cytogenet Genome Res. 2015;147(1):24-30. doi: 10.1159/000442068. Epub 2015 Dec 9.
2	The Krppel-like factor 15 as a molecular link between myogenic factors and a chromosome 4q transcriptional enhancer implicated in facioscapulohumeral dystrophy.J Biol Chem. 2011 Dec 30;286(52):44620-31. doi: 10.1074/jbc.M111.254052. Epub 2011 Sep 21.
3	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.