Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKSSG6N)

• DOT Name: T-cell surface glycoprotein CD1a (CD1A)
• Synonyms: T-cell surface antigen T6/Leu-6; hTa1 thymocyte antigen; CD antigen CD1a
• Gene Name: CD1A
• UniProt ID: CD1A_HUMAN
• PDB ID: 1ONQ; 1XZ0; 4X6C; 4X6D; 4X6E; 4X6F; 5J1A; 6NUX; 7KOZ; 7KP0; 7KP1; 7RYM; 7RYN; 7RYO; 7SH4
• Pfam ID: PF07654 ; PF16497
• Sequence:
  MLFLLLPLLAVLPGDGNADGLKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSN
  SSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCE
  LHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS
  DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG
  EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVKHSSLEGQDIVLYWEHHSSV
  GFIILAVIVPLLLLIGLALWFRKRCFC
• Function: Antigen-presenting protein that binds self and non-self lipid and glycolipid antigens and presents them to T-cell receptors on natural killer T-cells.
• Tissue Specificity: Expressed on cortical thymocytes, epidermal Langerhans cells, dendritic cells, on certain T-cell leukemias, and in various other tissues.
• KEGG Pathway:
  Tight junction (hsa04530)
  Hematopoietic cell lineage (hsa04640)
  Amoebiasis (hsa05146)
• Reactome Pathway: Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of T-cell surface glycoprotein CD1a (CD1A).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of T-cell surface glycoprotein CD1a (CD1A).	[2]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of T-cell surface glycoprotein CD1a (CD1A).	[3]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of T-cell surface glycoprotein CD1a (CD1A).	[4]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of T-cell surface glycoprotein CD1a (CD1A).	[5]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 decreases the expression of T-cell surface glycoprotein CD1a (CD1A).	[4]
24(S), 25-epoxycholesterol	DMW2KI5	Investigative	24(S), 25-epoxycholesterol decreases the expression of T-cell surface glycoprotein CD1a (CD1A).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of T-cell surface glycoprotein CD1a (CD1A).	[6]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Fetal-sex dependent genomic responses in the circulating lymphocytes of arsenic-exposed pregnant women in New Hampshire. Reprod Toxicol. 2017 Oct;73:184-195. doi: 10.1016/j.reprotox.2017.07.023. Epub 2017 Aug 6.
• [3] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [4] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [5] 9-cis-Retinoic acid (9cRA), a retinoid X receptor (RXR) ligand, exerts immunosuppressive effects on dendritic cells by RXR-dependent activation: inhibition of peroxisome proliferator-activated receptor gamma blocks some of the 9cRA activities, and precludes them to mature phenotype development. J Immunol. 2007 May 15;178(10):6130-9. doi: 10.4049/jimmunol.178.10.6130.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.