Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTL0PMQX)

• DOT Name: Fc receptor-like B (FCRLB)
• Synonyms: Fc receptor homolog expressed in B-cells protein 2; FREB-2; Fc receptor-like and mucin-like protein 2; Fc receptor-like protein 2; Fc receptor-related protein Y; FcRY
• Gene Name: FCRLB
• Related Disease: IgA nephropathy
• UniProt ID: FCRLB_HUMAN
• Pfam ID: PF13895
• Sequence:
  MWPLTALLLLVPSSGQAATLEKPILSLHPPWTTIFKGERVTLKCDGYHPLLLELQPISTL
  WYLGHLLLPSHKKSIEVQTPGVYRCQTRGAPVSDPIHLSVSNDWLILQVPYAPVFEGEPL
  VLRCRGWYDKVVYKLHYYHDGQAVRYFHSSANYTVLQARASDSGRYQCSGTMRIPVESAP
  MFSAKVAVTVQELFRAPVLRVMGPREARGAALGGVVLRCDTRLHPQKRDTPLQFAFYKYS
  RAVRRFDWGAEYTVPEPEVEELESYWCEAATATRSVRKRSPWLQLPGPGSPLDPASTTAP
  APWAAALAPGNRPLSFRKPPVSRSVPLVTSVRNTTSTGLQFPASGAPTAGPPACAPPTPL
  EQSAGALKPDVDLLLREMQLLKGLLSRVVLELKEPQALRELRGTPETPTSHFAVSPGTPE
  TTPVES
• Tissue Specificity: Expressed at low levels. Expressed in B-lymphocytes. Detected in tonsil, lung, kidney, spleen and placenta. Expressed by a small subset of germinal center B-cells in tonsils and by melanocytes (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
IgA nephropathy	DISZ8MTK	Strong	Genetic Variation	[1]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the methylation of Fc receptor-like B (FCRLB).	[2]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Fc receptor-like B (FCRLB).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Fc receptor-like B (FCRLB).	[7]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Fc receptor-like B (FCRLB).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Fc receptor-like B (FCRLB).	[5]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Fc receptor-like B (FCRLB).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Fc receptor-like B (FCRLB).	[8]

References

• [1] FCGR2B and FCRLB gene polymorphisms associated with IgA nephropathy.PLoS One. 2013 Apr 12;8(4):e61208. doi: 10.1371/journal.pone.0061208. Print 2013.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.