General Information of Drug Off-Target (DOT) (ID: OTLYX1ZZ)

DOT Name Transmembrane emp24 domain-containing protein 6 (TMED6)
Synonyms p24 family protein gamma-5; p24gamma5
Gene Name TMED6
Related Disease
Alveolar soft part sarcoma ( )
Colorectal carcinoma ( )
Esophageal cancer ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Lung cancer ( )
UniProt ID
TMED6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01105
Sequence
MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFA
HQTGYFYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCL
SNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYY
NFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alveolar soft part sarcoma DISLKJKZ Strong Altered Expression [1]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [1]
Esophageal cancer DISGB2VN Strong Altered Expression [1]
Gastric cancer DISXGOUK Strong Altered Expression [1]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [1]
Lung cancer DISCM4YA Strong Altered Expression [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [3]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [4]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [5]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [6]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [5]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [8]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Transmembrane emp24 domain-containing protein 6 (TMED6). [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 TMED6-COG8 is a novel molecular marker of TFE3 translocation renal cell carcinoma.Int J Clin Exp Pathol. 2015 Mar 1;8(3):2690-9. eCollection 2015.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
6 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
7 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
9 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.