Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLZJVLL)

• DOT Name: Pregnancy-specific beta-1-glycoprotein 11 (PSG11)
• Synonyms: PS-beta-G-11; PSBG-11; Pregnancy-specific glycoprotein 11; Pregnancy-specific beta-1-glycoprotein 13; PS-beta-G-13; PSBG-13; Pregnancy-specific glycoprotein 13
• Gene Name: PSG11
• Related Disease: Acute myelogenous leukaemia
• UniProt ID: PSG11_HUMAN
• Pfam ID: PF13895 ; PF13927 ; PF07686
• Sequence:
  MGPLSAPPCTEHIKWKGLLLTALLLNFWNLPTTAQVMIEAQPPKVSEGKDVLLLVHNLPQ
  NLTGYIWYKGQIRDLYHYITSYVVDGQIIIYGPAYSGRETVYSNASLLIQNVTREDAGSY
  TLHIIKRGDGTRGVTGYFTFTLYLETPKPSISSSNLNPREAMETVILTCNPETPDASYLW
  WMNGQSLPMTHRMQLSETNRTLFLFGVTKYTAGPYECEIWNSGSASRSDPVTLNLLHGPD
  LPRIFPSVTSYYSGENLDLSCFANSNPPAQYSWTINGKFQLSGQKLFIPQITPKHNGLYA
  CSARNSATGEESSTSLTIRVIAPPGLGTFAFNNPT
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Pregnancy-specific beta-1-glycoprotein 11 (PSG11).	[2]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Pregnancy-specific beta-1-glycoprotein 11 (PSG11).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Pregnancy-specific beta-1-glycoprotein 11 (PSG11).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Pregnancy-specific beta-1-glycoprotein 11 (PSG11).	[4]

References

• [1] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [2] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [3] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.