Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMOQSL4)

• DOT Name: Small integral membrane protein 12 (SMIM12)
• Gene Name: SMIM12
• UniProt ID: SIM12_HUMAN
• Pfam ID: PF15990
• Sequence:
  MWPVFWTVVRTYAPYVTFPVAFVVGAVGYHLEWFIRGKDPQPVEEEKSISERREDRKLDE
  LLGKDHTQVVSLKDKLEFAPKAVLNRNRPEKN

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Small integral membrane protein 12 (SMIM12).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Small integral membrane protein 12 (SMIM12).	[2]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Small integral membrane protein 12 (SMIM12).	[3]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Small integral membrane protein 12 (SMIM12).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Small integral membrane protein 12 (SMIM12).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Small integral membrane protein 12 (SMIM12).	[5]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [4] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.