Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMVU3ZS)

• DOT Name: Coiled-coil domain-containing protein 153 (DRC12)
• Gene Name: DRC12
• UniProt ID: CC153_HUMAN
• Sequence:
  MPPKNKEKGKKSGAQKKKKNWGADVVAESRHRLVVLEKELLRDHLALRRDEARRAKASED
  QLRQRLQGVEAELEGARSEGKAIYAEMSRQCHALQEDMQTRSKQLEEEVKGLRGQLEACQ
  REAAAAREEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGA
  ALRLHARHKEQQRQFGLTPPGSLRPPAPSL

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Coiled-coil domain-containing protein 153 (DRC12).	[1]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Coiled-coil domain-containing protein 153 (DRC12).	[2]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Coiled-coil domain-containing protein 153 (DRC12).	[3]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Coiled-coil domain-containing protein 153 (DRC12).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Coiled-coil domain-containing protein 153 (DRC12).	[4]

References

• [1] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [2] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [3] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.