Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTN8LSSF)
DOT Name | Aquaporin PIP1-2 (PIP1-2) | ||||
---|---|---|---|---|---|
Synonyms | AtPIP1;2; Plasma membrane intrinsic protein 1b; PIP1b; Transmembrane protein A; AthH2; TMP-A | ||||
Gene Name | PIP1-2 | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MEGKEEDVRVGANKFPERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIA
TFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFG LFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQPKQYQALGGGANTIAHGYTKGSGLGA EIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSL GAAIIFNKDNAWDDHWVFWVGPFIGAALAALYHVIVIRAIPFKSRS |
||||
Function |
Water channel required to facilitate the transport of water across cell membrane. Essential for the water permeability of the plasma membrane and for the morphology of the root system. Its function is impaired by Hg(2+). Inhibited by cytosolic acidosis which occurs during anoxia in roots.
|
||||
Tissue Specificity | Widely expressed. Expressed in roots and above ground. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
This DOT Affected the Drug Response of 1 Drug(s)
|
|||||||||||||||||||||||||