Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNBOOLJ)

• DOT Name: Immunoglobulin alpha Fc receptor (FCAR)
• Synonyms: IgA Fc receptor; CD antigen CD89
• Gene Name: FCAR
• UniProt ID: FCAR_HUMAN
• PDB ID: 1OVZ; 1OW0; 1UCT; 8SKU
• Pfam ID: PF00047
• Sequence:
  MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQL
  MIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVT
  GLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSL
  GPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVA
  LLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
• Function: Binds to the Fc region of immunoglobulins alpha. Mediates several functions including cytokine production.
• Tissue Specificity: Isoform A.1, isoform A.2 and isoform A.3 are differentially expressed between blood and mucosal myeloid cells. Isoform A.1, isoform A.2 and isoform A.3 are expressed in monocytes. Isoform A.1 and isoform A.2 are expressed in alveolar macrophages; however only one isoform is expressed at alveolar macrophages surfaces.
• KEGG Pathway:
  Phagosome (hsa04145)
  Staphylococcus aureus infection (hsa05150)
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Immunoglobulin alpha Fc receptor (FCAR).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Immunoglobulin alpha Fc receptor (FCAR).	[2]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Immunoglobulin alpha Fc receptor (FCAR).	[3]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Immunoglobulin alpha Fc receptor (FCAR).	[5]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Immunoglobulin alpha Fc receptor (FCAR).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Immunoglobulin alpha Fc receptor (FCAR).	[4]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [3] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [6] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.