Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNIBPPY)

DOT Name	Coiled-coil domain-containing protein 192 (CCDC192)
Gene Name	CCDC192
Related Disease	Schizophrenia ( )
UniProt ID	CC192_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MMPVDVCPRDRGSQWVWLEMGQCYSKKSVVPESDTSERSSMTSGSSESDIPQENKVSKAS LDTGQMAFTLAQLESLEICLKEAEEKAKALSEQLSVSEGTKSKLLEQVSRLEEKLEAVDH KEASGGPYEKMVLVKDQCIQKLQAEVKASQEQLIAQKLKHEKKVKKLQTDLATANAITVL ELNEKIKTLYEGKPAPREDSLLEGFCGGLPPVEEGDRKISLIMELSTQVSLQTERITQLK EVLEEKERKIQQLEAERSPHPPQEVKDPPGCLPEAPVFSTHDIPPVVSDENL

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Malathion	DMXZ84M	Approved	Malathion increases the expression of Coiled-coil domain-containing protein 192 (CCDC192).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Coiled-coil domain-containing protein 192 (CCDC192).	[3]
------------------------------------------------------------------------------------

References

1	Genome-Wide Association Study Detected Novel Susceptibility Genes for Schizophrenia and Shared Trans-Populations/Diseases Genetic Effect.Schizophr Bull. 2019 Jun 18;45(4):824-834. doi: 10.1093/schbul/sby140.
2	Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
3	Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.