Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNM7KL4)

DOT Name	Peroxisomal succinyl-coenzyme A thioesterase (ACOT4)
Synonyms	EC 3.1.2.3; Acyl-coenzyme A thioesterase 4; Acyl-CoA thioesterase 4; EC 3.1.2.2; PTE-2b; Peroxisomal acyl coenzyme A thioester hydrolase Ib; Peroxisomal long-chain acyl-CoA thioesterase Ib; PTE-Ib
Gene Name	ACOT4
UniProt ID	ACOT4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3K2I
EC Number	3.1.2.2; 3.1.2.3
Pfam ID	PF08840 ; PF04775
Sequence	MSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADARGEL DLERAPALGGSFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVVELEVLDGHDPEPGRLL CQAQHERHFLPPGVRRQSVRAGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAG HGFATLALAYYNFEDLPNNMDNISLEYFEEAVCYMLQHPQVKGPGIGLLGISLGADICLS MASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLRRIKVAFSGLVDIVDIRNALV GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGH YIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPK L
Function	Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels. Functions as a peroxisomal succinyl-coenzyme A thioesterase that can also hydrolyze glutaryl-CoA and long chain saturated acyl-CoAs.
Tissue Specificity	Strongest expression in liver and kidney and weaker expression in placenta, heart, and muscle.
KEGG Pathway	Fatty acid elongation (hsa00062 ) Biosynthesis of unsaturated fatty acids (hsa01040 ) Metabolic pathways (hsa01100 ) Ovarian steroidogenesis (hsa04913 )
Reactome Pathway	Peroxisomal protein import (R-HSA-9033241 ) Beta-oxidation of very long chain fatty acids (R-HSA-390247 )
BioCyc Pathway	MetaCyc:HS16863-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[4]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[5]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[6]
GW7647	DM9RD0C	Investigative	GW7647 increases the expression of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[7]
CITCO	DM0N634	Investigative	CITCO increases the expression of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Peroxisomal succinyl-coenzyme A thioesterase (ACOT4).	[3]
------------------------------------------------------------------------------------

References

1	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
2	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
3	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
4	Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
5	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
6	Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
7	Farnesol induces fatty acid oxidation and decreases triglyceride accumulation in steatotic HepaRG cells. Toxicol Appl Pharmacol. 2019 Feb 15;365:61-70.