Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNTGAEV)

DOT Name	Izumo sperm-egg fusion protein 2 (IZUMO2)
Gene Name	IZUMO2
UniProt ID	IZUM2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15005
Sequence	MPLALTLLLLSGLGAPGGWGCLQCDPLVLEALGHLRSALIPSRFQLEQLQARAGAVLMGM EGPFFRDYALNVFVGKVETNQLDLVASFVKNQTQHLMGNSLKDEPLLEELVTLRANVIKE FKKVLISYELKACNPKLCRLLKEEVLDCLHCQRITPKCIHKKYCFVDRQPRVALQYQMDS KYPRNQALLGILISVSLAVFVFVVIVVSACTYRQNRKLLLQ
Reactome Pathway	Acrosome Reaction and Sperm (R-HSA-1300645 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Izumo sperm-egg fusion protein 2 (IZUMO2).	[1]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Izumo sperm-egg fusion protein 2 (IZUMO2).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Izumo sperm-egg fusion protein 2 (IZUMO2).	[3]
------------------------------------------------------------------------------------

References

1	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
3	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.