Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOKL8BF)

• DOT Name: Lysoplasmalogenase TMEM86B (TMEM86B)
• Synonyms: EC 3.3.2.2; Transmembrane protein 86B
• Gene Name: TMEM86B
• UniProt ID: TM86B_HUMAN
• EC Number: 3.3.2.2
• Pfam ID: PF07947
• Sequence:
  MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCL
  AGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPL
  QPGLLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFT
  LSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALRSPVPKTD
• Function: Catalyzes the hydrolysis of the vinyl ether bond of choline or ethanolamine lysoplasmalogens, forming fatty aldehyde and glycerophosphocholine or glycerophosphoethanolamine, respectively and is specific for the sn-2-deacylated (lyso) form of plasmalogen.
• KEGG Pathway:
  Ether lipid metabolism (hsa00565)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Acyl chain remodelling of PC (R-HSA-1482788)
• BioCyc Pathway: MetaCyc:ENSG00000180089-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Lysoplasmalogenase TMEM86B (TMEM86B).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Lysoplasmalogenase TMEM86B (TMEM86B).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Lysoplasmalogenase TMEM86B (TMEM86B).	[1]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Lysoplasmalogenase TMEM86B (TMEM86B).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Lysoplasmalogenase TMEM86B (TMEM86B).	[5]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Lysoplasmalogenase TMEM86B (TMEM86B).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Lysoplasmalogenase TMEM86B (TMEM86B).	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Lysoplasmalogenase TMEM86B (TMEM86B).	[3]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.