Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOMJVVB)

• DOT Name: Uncharacterized protein C12orf54 (C12ORF54)
• Gene Name: C12ORF54
• Related Disease: Non-small-cell lung cancer
• UniProt ID: CL054_HUMAN
• Pfam ID: PF15732
• Sequence:
  MAQHPCQDQEQKVEMTSKQQRSTSIEETMRPQEKQVTITETLWDQVLTVFKDIQKELQED
  ARIRGMSNCSMTPMTSAPRTGSIRPPDSLMTPKLRRLQFSSGEQPSGGRIHNLKTQLFSQ
  SAYYPGP

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Uncharacterized protein C12orf54 (C12ORF54).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Uncharacterized protein C12orf54 (C12ORF54).	[5]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Uncharacterized protein C12orf54 (C12ORF54).	[3]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Uncharacterized protein C12orf54 (C12ORF54).	[4]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Uncharacterized protein C12orf54 (C12ORF54).	[3]

References

• [1] Detection of autoantibodies against cancer-testis antigens in non-small cell lung cancer.Lung Cancer. 2018 Nov;125:157-163. doi: 10.1016/j.lungcan.2018.09.012. Epub 2018 Sep 17.
• [2] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [3] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [4] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.