Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOQJBRZ)

• DOT Name: Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3)
• Synonyms: Rhodanese domain-containing protein 3
• Gene Name: TSTD3
• UniProt ID: TSTD3_HUMAN
• Pfam ID: PF00581
• Sequence:
  MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQK
  IPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3).	[1]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3).	[2]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3).	[3]

References

• [1] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [2] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [3] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [4] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [5] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.