Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPEKVOM)

• DOT Name: Transcription factor SOX-14 (SOX14)
• Synonyms: Protein SOX-28
• Gene Name: SOX14
• Related Disease:
  Advanced cancer
  Neoplasm
  Cervical cancer
  Cervical carcinoma
  Mobius syndrome
  Squamous cell carcinoma
• UniProt ID: SOX14_HUMAN
• Pfam ID: PF00505 ; PF12336
• Sequence:
  MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDE
  AKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLS
  APEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSL
  SCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAM
• Function: Acts as a negative regulator of transcription.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Altered Expression	[1]
Cervical cancer	DISFSHPF	Strong	Biomarker	[2]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[1]
Mobius syndrome	DIS9YXP5	Strong	Genetic Variation	[3]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Transcription factor SOX-14 (SOX14).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Transcription factor SOX-14 (SOX14).	[6]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Transcription factor SOX-14 (SOX14).	[7]

References

• [1] SOX14 activates the p53 signaling pathway and induces apoptosis in a cervical carcinoma cell line.PLoS One. 2017 Sep 19;12(9):e0184686. doi: 10.1371/journal.pone.0184686. eCollection 2017.
• [2] Genome-wide methylome analysis using MethylCap-seq uncovers 4 hypermethylated markers with high sensitivity for both adeno- and squamous-cell cervical carcinoma.Oncotarget. 2016 Dec 6;7(49):80735-80750. doi: 10.18632/oncotarget.12598.
• [3] SOX14 is a candidate gene for limb defects associated with BPES and Mbius syndrome.Hum Genet. 2000 Mar;106(3):269-76. doi: 10.1007/s004390051037.
• [4] Novel tumor suppressor candidates on chromosome 3 revealed by NotI-microarrays in cervical cancer.Epigenetics. 2013 Apr;8(4):409-20. doi: 10.4161/epi.24233. Epub 2013 Mar 11.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Deguelin inhibits growth of breast cancer cells by modulating the expression of key members of the Wnt signaling pathway. Cancer Prev Res (Phila). 2009 Nov;2(11):942-50. doi: 10.1158/1940-6207.CAPR-08-0232. Epub 2009 Oct 27.