Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPRVZQM)

DOT Name	T-cell leukemia/lymphoma protein 1A (TCL1A)
Synonyms	Oncogene TCL-1; Oncogene TCL1; Protein p14 TCL1
Gene Name	TCL1A
UniProt ID	TCL1A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1JSG
Pfam ID	PF01840
Sequence	MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Function	Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival.
Tissue Specificity	Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation.
KEGG Pathway	PI3K-Akt sig.ling pathway (hsa04151 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of T-cell leukemia/lymphoma protein 1A (TCL1A).	[1]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid affects the expression of T-cell leukemia/lymphoma protein 1A (TCL1A).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of T-cell leukemia/lymphoma protein 1A (TCL1A).	[2]
------------------------------------------------------------------------------------

References

1	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
2	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
3	Cancer-related proteins in serum are altered in workers occupationally exposed to polycyclic aromatic hydrocarbons: a cross-sectional study. Carcinogenesis. 2019 Jul 6;40(6):771-781. doi: 10.1093/carcin/bgz022.