Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPUXCSA)

• DOT Name: Spermatogenesis-associated serine-rich protein 1 (SPATS1)
• Gene Name: SPATS1
• UniProt ID: SPAS1_HUMAN
• Pfam ID: PF15160
• Sequence:
  MSPSMLTGNSPRGCRLPSISSTTCGRQLEKVPEKRDSGMTEVERTYSANCSDFLESKGCF
  ANTTPSGKSVSSSSSVETGPSVSEPPGLPRVSAYVDTTADLDRKLSFSHSDHSSEMSLPE
  VQKDKYPEEFSLLKLQTKDGHRPEWTFYPRFSSNIHTYHVGKQCFFNGVFLGNKRSLSER
  TVDKCFGRKKYDIDPRNGIPKLTPGDNPYMYPEQSKGFHKAGSMLPPVNFSIVPYEKKFD
  TFIPLEPLPQIPNLPFWVKEKANSLKNEIQEVEELDNWQPAVPLMHMLHLSGALDFPRQS

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Spermatogenesis-associated serine-rich protein 1 (SPATS1).	[1]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Spermatogenesis-associated serine-rich protein 1 (SPATS1).	[2]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the expression of Spermatogenesis-associated serine-rich protein 1 (SPATS1).	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Spermatogenesis-associated serine-rich protein 1 (SPATS1).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Spermatogenesis-associated serine-rich protein 1 (SPATS1).	[5]

References

• [1] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [2] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [3] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [4] Anti-inflammatory agent indomethacin reduces invasion and alters metabolism in a human breast cancer cell line. Neoplasia. 2007 Mar;9(3):222-35.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.