Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQZXHST)

• DOT Name: Olfactory receptor 12D2 (OR12D2)
• Synonyms: Hs6M1-20; Olfactory receptor OR6-28
• Gene Name: OR12D2
• UniProt ID: O12D2_HUMAN
• Pfam ID: PF13853
• Sequence:
  MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFF
  LGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHSLGSTESMLFAVMAFDL
  SVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIK
  PLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITYLFFKTRSCSMLCKALSTC
  ASHFMVVILFYAPVLFTYIHPALESFMDQDRIVAIMYTVVTPVLNPLIYTLRNKEVKGAL
  GRVIRRL
• Function: Odorant receptor.
• KEGG Pathway: Olfactory transduction (hsa04740)
• Reactome Pathway: Expression and translocation of olfactory receptors (R-HSA-9752946)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Olfactory receptor 12D2 (OR12D2).	[1]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Olfactory receptor 12D2 (OR12D2).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Olfactory receptor 12D2 (OR12D2).	[3]

References

• [1] Gamma-irradiation and doxorubicin treatment of normal human cells cause cell cycle arrest via different pathways. Mol Cells. 2005 Dec 31;20(3):331-8.
• [2] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.