Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRXSK61)

DOT Name	Transmembrane protein 213 (TMEM213)
Gene Name	TMEM213
Related Disease	Clear cell renal carcinoma ( )
UniProt ID	TM213_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15192
Sequence	MQRLPAATRATLILSLAFASLHSACSAEASSSNSSSLTAHHPDPGTLEQCLNVDFCPQAA RCCRTGVDEYGWIAAAVGWSLWFLTLILLCVDKLMKLTPDEPKDLQA

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Transmembrane protein 213 (TMEM213).	[2]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transmembrane protein 213 (TMEM213).	[3]
------------------------------------------------------------------------------------

References

1	FUT11 as a potential biomarker of clear cell renal cell carcinoma progression based on meta-analysis of gene expression data.Tumour Biol. 2014 Mar;35(3):2607-17. doi: 10.1007/s13277-013-1344-4. Epub 2013 Dec 8.
2	Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.