| DOT Name |
5'-AMP-activated protein kinase subunit gamma-3 (PRKAG3)
|
| Synonyms |
AMPK gamma3; AMPK subunit gamma-3 |
| Gene Name |
PRKAG3
|
| Related Disease |
- B-cell lymphoma ( )
- Breast cancer ( )
- Breast carcinoma ( )
- Carbohydrate metabolism disorder ( )
- Estrogen-receptor positive breast cancer ( )
- Polycystic ovarian syndrome ( )
- Wolff-Parkinson-White syndrome ( )
|
| UniProt ID |
|
| 3D Structure |
|
| Pfam ID |
|
| Sequence |
MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRW
TRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSD
CTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPG
AQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALVANGVRAAPLWDSKKQSFVGM
LTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGCFKPLVSISPNDSLFEAVYTL
IKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQDLGIGTFRDLA
VVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLS
PAGIDALGA
|
| Function |
AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. AMPK also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. The AMPK gamma3 subunit is a non-catalytic subunit with a regulatory role in muscle energy metabolism. It mediates binding to AMP, ADP and ATP, leading to AMPK activation or inhibition: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.
|
| Tissue Specificity |
Skeletal muscle, with weak expression in heart and pancreas. |
| KEGG Pathway |
- FoxO sig.ling pathway (hsa04068 )
- AMPK sig.ling pathway (hsa04152 )
- Longevity regulating pathway (hsa04211 )
- Longevity regulating pathway - multiple species (hsa04213 )
- Apelin sig.ling pathway (hsa04371 )
- Tight junction (hsa04530 )
- Circadian rhythm (hsa04710 )
- Thermogenesis (hsa04714 )
- Insulin sig.ling pathway (hsa04910 )
- Adipocytokine sig.ling pathway (hsa04920 )
- Oxytocin sig.ling pathway (hsa04921 )
- Glucagon sig.ling pathway (hsa04922 )
- Insulin resistance (hsa04931 )
- Non-alcoholic fatty liver disease (hsa04932 )
- Alcoholic liver disease (hsa04936 )
- Hypertrophic cardiomyopathy (hsa05410 )
|
| Reactome Pathway |
- Macroautophagy (R-HSA-1632852 )
- Activation of PPARGC1A (PGC-1alpha) by phosphorylation (R-HSA-2151209 )
- Energy dependent regulation of mTOR by LKB1-AMPK (R-HSA-380972 )
- TP53 Regulates Metabolic Genes (R-HSA-5628897 )
- Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756 )
- Lipophagy (R-HSA-9613354 )
- Activation of AMPK downstream of NMDARs (R-HSA-9619483 )
- Translocation of SLC2A4 (GLUT4) to the plasma membrane (R-HSA-1445148 )
|
|
|
|
|
|
|
