| DOT Name |
Toll/interleukin-1 receptor domain-containing adapter protein (TIRAP)
|
| Synonyms |
TIR domain-containing adapter protein; Adaptor protein Wyatt; MyD88 adapter-like protein; MyD88-2 |
| Gene Name |
TIRAP
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
2NDH ; 2Y92 ; 3UB2 ; 3UB3 ; 3UB4 ; 4FZ5 ; 4LQD ; 5T7Q ; 5UZB |
| Pfam ID |
|
| Sequence |
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
|
| Function |
Adapter involved in TLR2, TLR4 and RAGE signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha (TNF) and interleukin-6 (IL6).
|
| Tissue Specificity |
Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain. |
| KEGG Pathway |
- NF-kappa B sig.ling pathway (hsa04064 )
- Toll-like receptor sig.ling pathway (hsa04620 )
- Alcoholic liver disease (hsa04936 )
- Pathogenic Escherichia coli infection (hsa05130 )
- Salmonella infection (hsa05132 )
- Pertussis (hsa05133 )
- Tuberculosis (hsa05152 )
- Hepatitis B (hsa05161 )
- PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
- Lipid and atherosclerosis (hsa05417 )
|
| Reactome Pathway |
- MyD88 (R-HSA-166058 )
- MyD88 deficiency (TLR2/4) (R-HSA-5602498 )
- IRAK4 deficiency (TLR2/4) (R-HSA-5603041 )
- ER-Phagosome pathway (R-HSA-1236974 )
|
|
|
|
|
|
|
