Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT2T3DU)

• DOT Name: Protein LEG1 homolog (C6ORF58)
• Gene Name: C6ORF58
• Related Disease:
  Neoplasm
  Matthew-Wood syndrome
• UniProt ID: LEG1H_HUMAN
• Pfam ID: PF05612
• Sequence:
  MAFLPSWVCVLVGSFSASLAGTSNLSETEPPLWKESPGQLSDYRVENSMYIINPWVYLER
  MGMYKIILNQTARYFAKFAPDNEQNILWGLPLQYGWQYRTGRLADPTRRTNCGYESGDHM
  CISVDSWWADLNYFLSSLPFLAAVDSGVMGISSDQVRLLPPPKNERKFCYDVSSCRSSFP
  ETMNKWNTFYQYLQSPFSKFDDLLKYLWAAHTSTLADNIKSFEDRYDYYSKAEAHFERSW
  VLAVDHLAAVLFPTTLIRSYKFQKGMPPRILLNTDVAPFISDFTAFQNVVLVLLNMLDNV
  DKSIGYLCTEKSNVYRDHSESSSRSYGNNS
• Function: May be involved in early liver development.
• Tissue Specificity: Detected in saliva and in hypomineralized dental enamel (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Protein LEG1 homolog (C6ORF58).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Protein LEG1 homolog (C6ORF58).	[6]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Protein LEG1 homolog (C6ORF58).	[4]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Protein LEG1 homolog (C6ORF58).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Protein LEG1 homolog (C6ORF58).	[5]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Protein LEG1 homolog (C6ORF58).	[7]

References

• [1] BRAF and KRAS mutations in sporadic glomus tumors.Am J Dermatopathol. 2012 Jul;34(5):533-5. doi: 10.1097/DAD.0b013e31823931b4.
• [2] Proteomic identification of potential prognostic biomarkers in resectable pancreatic ductal adenocarcinoma.Proteomics. 2014 Apr;14(7-8):945-55. doi: 10.1002/pmic.201300402. Epub 2014 Mar 3.
• [3] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [4] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [5] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.