Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTT9M6SH)
DOT Name | TBC1 domain family member 21 (TBC1D21) | ||||
---|---|---|---|---|---|
Synonyms | Male germ cell Rab GTPase-activating protein | ||||
Gene Name | TBC1D21 | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFICVNILERGLHP
FVRTEAWKFLTGYFSWQSSQDERLTVDSMRRKNYKALCQMYEKIQPLLENLHRNFTETRN NIARDIQKIYDKDPLGNVLIDKKRLEKILLLSYVCNTQAEYQQGFHEMMMLFQLMVEHDH ETFWLFQFFLQKTEHSCVINIGVAKNLDMLSTLITFLDPVFAEHLKGKGAGAVQSLFPWF CFCFQRAFKSFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQVLQESMGGDDILLAC NNLIDLDADELISAACVVYAELIQKDVPQTLKDFFL |
||||
Function |
Acts as a GTPase-activating protein for Rab family protein(s). Essential for the establishment of male fertility, and is required for both the production of normal sperm number and sperm function. Plays an important role in the formation of intact mitochondria, outer dense fibers and axoneme within the sperm tail. Essential for sperm mitochondrial sheath formation and for the interactions of ARMC12 with VDAC2 and VDAC3. May be involved in acrosome formation and cytoskeletal reorganization during spermiogenesis, possibly by regulating RAB3A activity.
|
||||
Tissue Specificity | Expressed in round and elongated spermatids (at protein level). Expressed specifically in adult testis and very weakly in fetal brain. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||
References