Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTRI5WO)

DOT Name	Epiphycan (EPYC)
Synonyms	Dermatan sulfate proteoglycan 3; Proteoglycan-Lb; PG-Lb; Small chondroitin/dermatan sulfate proteoglycan
Gene Name	EPYC
Related Disease	Cornea plana ( ) Schizophrenia ( )
UniProt ID	EPYC_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00560 ; PF13855 ; PF01462
Sequence	MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIAT VMPSGNRELLTPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLL CTCISTTVYCDDHELDAIPPLPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLIS EIDEDAFRKLPQLRELVLRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLH HLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNVKNLTYIRKALEDIRLDGNP INLSKTPQAYMCLPRLPVGSLV
Function	May have a role in bone formation and also in establishing the ordered structure of cartilage through matrix organization.
Tissue Specificity	Cartilage, ligament, and placenta.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Cornea plana	DISE38HI	Strong	Genetic Variation	[1]
Schizophrenia	DISSRV2N	No Known	Unknown	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Epiphycan (EPYC).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Epiphycan (EPYC).	[4]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Epiphycan (EPYC).	[3]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Epiphycan (EPYC).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Epiphycan (EPYC).	[6]
------------------------------------------------------------------------------------

References

1	Autosomal dominant cornea plana is not associated with pathogenic mutations in DCN, DSPG3, FOXC1, KERA, LUM, or PITX2.Ophthalmic Genet. 2007 Jun;28(2):57-67. doi: 10.1080/13816810701351321.
2	The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
3	Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
4	Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
5	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
6	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.