Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTRSGJR)

DOT Name Coiled-coil domain-containing protein 74B (CCDC74B)
Gene Name CCDC74B
UniProt ID
CC74B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14917 ; PF14916
Sequence
MSGAGVAAGTRPPSSPTPGSRRRRQRPSVGVQSLRPQSPQLRQSDPQKRNLDLEKSLQFL
QQQHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDGPSGNHLSRASAPLGARWVCI
NGVWVEPGGPSPARLKEGSSRTHRPGGKHGRLAGGSADTVRSPADSLSTSSFQSVKSISN
SGKARPQPGSFNKQDSKADVPQKADLEEEPLLHNSKLDKVPGVQGQARKEKAEASNAGAA
CMGNSQHQGRQMGAAAHPPMILPLPLRKPTTLRQCEVLIRELWNTNLLQTQELQHLKSLL
EGSQRPQAVPEEASFPRDQEATHFPKVSTKSLSKKCLLLSPPVAERAILPALKQTPKNNF
AERQKRLQAMQKRRLHRSVL

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Coiled-coil domain-containing protein 74B (CCDC74B). [1]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Coiled-coil domain-containing protein 74B (CCDC74B). [2]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Coiled-coil domain-containing protein 74B (CCDC74B). [3]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Coiled-coil domain-containing protein 74B (CCDC74B). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Coiled-coil domain-containing protein 74B (CCDC74B). [5]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Coiled-coil domain-containing protein 74B (CCDC74B). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
2 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
3 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
4 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
5 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
6 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.