Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUTG7PL)

DOT Name Acrosomal protein SP-10 (ACRV1)
Synonyms Acrosomal vesicle protein 1
Gene Name ACRV1
Related Disease
Severe acute respiratory syndrome (SARS) ( )
UniProt ID
ASPX_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSS
GLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPS
GEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPIS
STSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCP
SMNLFSHGTRMQIICCRNQSFCNKI
Tissue Specificity Testis.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Severe acute respiratory syndrome (SARS) DISYW14W Limited Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Acrosomal protein SP-10 (ACRV1). [2]
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of Acrosomal protein SP-10 (ACRV1). [3]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Acrosomal protein SP-10 (ACRV1). [4]
------------------------------------------------------------------------------------

References

1 Design and biological activities of novel inhibitory peptides for SARS-CoV spike protein and angiotensin-converting enzyme 2 interaction.Antiviral Res. 2006 Feb;69(2):70-6. doi: 10.1016/j.antiviral.2005.10.005. Epub 2005 Nov 28.
2 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
3 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.