Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUVJI3H)

• DOT Name: Solute carrier family 22 member 10 (SLC22A10)
• Synonyms: Organic anion transporter 5
• Gene Name: SLC22A10
• Related Disease:
  Conotruncal heart malformations
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
• UniProt ID: S22AA_HUMAN
• Pfam ID: PF00083
• Sequence:
  MAFEELLSQVGGLGRFQMLHLVFILPSLMLLIPHILLENFAAAIPGHRCWVHMLDNNTGS
  GNETGILSEDALLRISIPLDSNLRPEKCRRFVHPQWQLLHLNGTIHSTSEADTEPCVDGW
  VYDQSYFPSTIVTKWDLVCDYQSLKSVVQFLLLTGMLVGGIIGGHVSDRFGRRFILRWCL
  LQLAITDTCAAFAPTFPVYCVLRFLAGFSSMIIISNNSLPITEWIRPNSKALVVILSSGA
  LSIGQIILGGLAYVFRDWQTLHVVASVPFFVFFLLSRWLVESARWLIITNKLDEGLKALR
  KVARTNGIKNAEETLNIEVVRSTMQEELDAAQTKTTVCDLFRNPSMRKRICILVFLRFAN
  TIPFYGTMVNLQHVGSNIFLLQVLYGAVALIVRCLALLTLNHMGRRISQILFMFLVGLSI
  LANTFVPKEMQTLRVALACLGIGCSAATFSSVAVHFIELIPTVLRARASGIDLTASRIGA
  ALAPLLMTLTVFFTTLPWIIYGIFPIIGGLIVFLLPETKNLPLPDTIKDVENQKKNLKEK
  A
• Tissue Specificity: Detected in fetal and adult liver, and in adult kidney.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Conotruncal heart malformations	DIS7FMIG	Strong	Genetic Variation	[1]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[2]
Non-small-cell lung cancer	DIS5Y6R9	Limited	Biomarker	[2]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[2]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Solute carrier family 22 member 10 (SLC22A10).	[3]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Solute carrier family 22 member 10 (SLC22A10).	[4]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Solute carrier family 22 member 10 (SLC22A10).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Solute carrier family 22 member 10 (SLC22A10).	[5]

References

• [1] Genome-wide association study of maternal and inherited loci for conotruncal heart defects.PLoS One. 2014 May 6;9(5):e96057. doi: 10.1371/journal.pone.0096057. eCollection 2014.
• [2] Identification of recurrent fusion genes across multiple cancer types.Sci Rep. 2019 Jan 31;9(1):1074. doi: 10.1038/s41598-019-38550-6.
• [3] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [4] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [5] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.