Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVBVUAV)

DOT Name KRAB domain-containing protein 5 (KRBOX5)
Gene Name KRBOX5
UniProt ID
KRBX5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01352
Sequence
MGLLTFRDVAIEFSREEWEHLDSDQKLLYGDVMLENYGNLVSLGLAVSKPDLITFLEQRK
EPWNVKSAETVAIQPDIFSHDTQGLLRKKLIEASFQKVILDGYGSCGPQNLNLRKEWESE
GKIILW
Reactome Pathway
Generic Transcription Pathway (R-HSA-212436 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of KRAB domain-containing protein 5 (KRBOX5). [1]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of KRAB domain-containing protein 5 (KRBOX5). [2]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate decreases the expression of KRAB domain-containing protein 5 (KRBOX5). [3]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of KRAB domain-containing protein 5 (KRBOX5). [5]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of KRAB domain-containing protein 5 (KRBOX5). [4]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
3 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.