Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVC407Y)

DOT Name	CMRF35-like molecule 7 (CD300LB)
Synonyms	CLM-7; CD300 antigen-like family member B; CMRF35-A2; Immune receptor expressed on myeloid cells 3; IREM-3; Leukocyte mono-Ig-like receptor 5; Triggering receptor expressed on myeloid cells 5; TREM-5; CD antigen CD300b
Gene Name	CD300LB
Related Disease	Bacterial infection ( )
UniProt ID	CLM7_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF07686
Sequence	MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKI LIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVI VDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPE EPGEQPIYMNFSEPLTKDMAT
Function	Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Tissue Specificity	Expressed exclusively in myeloid lineages.
Reactome Pathway	DAP12 interactions (R-HSA-2172127 ) Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Bacterial infection	DIS5QJ9S	moderate	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of CMRF35-like molecule 7 (CD300LB).	[2]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of CMRF35-like molecule 7 (CD300LB).	[3]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 increases the expression of CMRF35-like molecule 7 (CD300LB).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of CMRF35-like molecule 7 (CD300LB).	[4]
------------------------------------------------------------------------------------

References

1	Lipopolysaccharide-Induced CD300b Receptor Binding to Toll-like Receptor 4 Alters Signaling to Drive Cytokine Responses that Enhance Septic Shock.Immunity. 2016 Jun 21;44(6):1365-78. doi: 10.1016/j.immuni.2016.05.005. Epub 2016 May 31.
2	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3	PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.