Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXFEQ37)

• DOT Name: IQ domain-containing protein F1 (IQCF1)
• Gene Name: IQCF1
• UniProt ID: IQCF1_HUMAN
• Pfam ID: PF00612
• Sequence:
  MEEKQPQKTKEPSKEDEPQQKEMPTHLSLGAESKAEAKTPVLVETQTVDNANEKSEKPPE
  NQKKLSDKDTVATKIQAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEA
  FSRKEWAAVTLQSQARMWRIRRRYCQVLNAVRIIQAYWRCRSCASRGFIKGQYRVTANQL
  HLQLEILLDSGPCIVTECIPFSIKE
• Function: Involved in sperm capacitation and acrosome reaction.

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of IQ domain-containing protein F1 (IQCF1).	[1]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of IQ domain-containing protein F1 (IQCF1).	[2]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of IQ domain-containing protein F1 (IQCF1).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of IQ domain-containing protein F1 (IQCF1).	[4]

References

• [1] Protein expression profiling identifies molecular targets of quercetin as a major dietary flavonoid in human colon cancer cells. Proteomics. 2004 Jul;4(7):2160-74.
• [2] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [3] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [4] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.