Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXM6IJM)

• DOT Name: Serpin A11 (SERPINA11)
• Gene Name: SERPINA11
• Related Disease:
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
• UniProt ID: SPA11_HUMAN
• Pfam ID: PF00079
• Sequence:
  MGPAWLWLLGTGILASVHCQPLLAHGDKSLQGPQPPRHQLSEPAPAYHRITPTITNFALR
  LYKELAADAPGNIFFSPVSISTTLALLSLGAQANTSALILEGLGFNLTETPEADIHQGFR
  SLLHTLALPSPKLELKVGNSLFLDKRLKPRQHYLDSIKELYGAFAFSANFTDSVTTGRQI
  NDYLRRQTYGQVVDCLPEFSQDTFMVLANYIFFKAKWKHPFSRYQTQKQESFFVDERTSL
  QVPMMHQKEMHRFLYDQDLACTVLQIEYRGNALALLVLPDPGKMKQVEAALQPQTLRKWG
  QLLLPSLLDLHLPRFSISGTYNLEDILPQIGLTNILNLEADFSGVTGQLNKTISKVSHKA
  MVDMSEKGTEAGAASGLLSQPPSLNTMSDPHAHFNRPFLLLLWEVTTQSLLFLGKVVNPV
  AG

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Altered Expression	[1]
Liver cancer	DISDE4BI	Strong	Altered Expression	[1]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Serpin A11 (SERPINA11).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Serpin A11 (SERPINA11).	[3]

References

• [1] Identification of latent biomarkers in hepatocellular carcinoma by ultra-deep whole-transcriptome sequencing.Oncogene. 2014 Sep 25;33(39):4786-94. doi: 10.1038/onc.2013.424. Epub 2013 Oct 21.
• [2] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [3] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.