Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXOE752)

DOT Name TBC1 domain family member 13 (TBC1D13)
Gene Name TBC1D13
UniProt ID
TBC13_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00566
Sequence
MSSLHKSRIADFQDVLKEPSIALEKLRELSFSGIPCEGGLRCLCWKILLNYLPLERASWT
SILAKQRELYAQFLREMIIQPGIAKANMGVSREDVTFEDHPLNPNPDSRWNTYFKDNEVL
LQIDKDVRRLCPDISFFQRATDYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVT
NMSSPHKNSVPSSLNEYEVLPNGCEAHWEVVERILFIYAKLNPGIAYVQGMNEIVGPLYY
TFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDSQCGITYKMEKVYSTLKDKDV
ELYLKLQEQNIKPQFFAFRWLTLLLSQEFLLPDVIRIWDSLFADDNRFDFLLLVCCAMLM
LIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDSK
Function Acts as a GTPase-activating protein for RAB35. Together with RAB35 may be involved in regulation of insulin-induced glucose transporter SLC2A4/GLUT4 translocation to the plasma membrane in adipocytes.
Reactome Pathway
TBC/RABGAPs (R-HSA-8854214 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of TBC1 domain family member 13 (TBC1D13). [1]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of TBC1 domain family member 13 (TBC1D13). [2]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of TBC1 domain family member 13 (TBC1D13). [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of TBC1 domain family member 13 (TBC1D13). [4]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of TBC1 domain family member 13 (TBC1D13). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of TBC1 domain family member 13 (TBC1D13). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
2 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
3 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
4 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
6 Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.