Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXS6OT9)

DOT Name LHFPL tetraspan subfamily member 1 protein (LHFPL1)
Synonyms Lipoma HMGIC fusion partner-like 1 protein
Gene Name LHFPL1
UniProt ID
LHPL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF10242
Sequence
MRSSLTMVGTLWAFLSLVTAVTSSTSYFLPYWLFGSQMGKPVSFSTFRRCNYPVRGEGHS
LIMVEECGRYASFNAIPSLAWQMCTVVTGAGCALLLLVALAAVLGCCMEELISRMMGRCM
GAAQFVGGLLISSGCALYPLGWNSPEIMQTCGNVSNQFQLGTCRLGWAYYCAGGGAAAAM
LICTWLSCFAGRNPKPVILVESIMRNTNSYAMELDHCLKP
Tissue Specificity Widely expressed. Expressed at high levels in lung, thymus, skeletal muscle, colon and ovary.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of LHFPL tetraspan subfamily member 1 protein (LHFPL1). [1]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of LHFPL tetraspan subfamily member 1 protein (LHFPL1). [4]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of LHFPL tetraspan subfamily member 1 protein (LHFPL1). [2]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of LHFPL tetraspan subfamily member 1 protein (LHFPL1). [3]
------------------------------------------------------------------------------------

References

1 Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
2 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
3 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
4 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.