Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYNB7Y5)

• DOT Name: Myelin-oligodendrocyte glycoprotein (MOG)
• Gene Name: MOG
• Related Disease: Narcolepsy 7
• UniProt ID: MOG_HUMAN
• Pfam ID: PF07686
• Sequence:
  MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKN
  ATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFS
  DEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQY
  RLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFL
  EELRNPF
• Function: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication; (Microbial infection) Acts as a receptor for rubella virus.
• Tissue Specificity: Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Narcolepsy 7	DISC8XN6	Limited	Unknown	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Myelin-oligodendrocyte glycoprotein (MOG).	[2]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Myelin-oligodendrocyte glycoprotein (MOG).	[4]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Myelin-oligodendrocyte glycoprotein (MOG).	[5]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Myelin-oligodendrocyte glycoprotein (MOG).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Myelin-oligodendrocyte glycoprotein (MOG).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Myelin-oligodendrocyte glycoprotein (MOG).	[9]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Myelin-oligodendrocyte glycoprotein (MOG).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Myelin-oligodendrocyte glycoprotein (MOG).	[8]

References

• [1] A missense mutation in myelin oligodendrocyte glycoprotein as a cause of familial narcolepsy with cataplexy. Am J Hum Genet. 2011 Sep 9;89(3):474-9. doi: 10.1016/j.ajhg.2011.08.007.
• [2] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [5] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [6] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [7] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.