Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZHIJ44)

• DOT Name: Placenta-specific protein 9 (PLAC9)
• Gene Name: PLAC9
• UniProt ID: PLAC9_HUMAN
• Pfam ID: PF15205
• Sequence:
  MRPLLCALTGLALLRAAGSLAAAEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTV
  DHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Placenta-specific protein 9 (PLAC9).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Placenta-specific protein 9 (PLAC9).	[2]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Placenta-specific protein 9 (PLAC9).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Placenta-specific protein 9 (PLAC9).	[4]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Placenta-specific protein 9 (PLAC9).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Placenta-specific protein 9 (PLAC9).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [4] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [5] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.