Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZHWPG7)

DOT Name	Telomerase RNA component interacting RNase (TRIR)
Synonyms	EC 3.1.13.-; Exoribonuclease TRIR
Gene Name	TRIR
UniProt ID	TRIR_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.1.13.-
Sequence	MAARGRRAEPQGREAPGPAGGGGGGSRWAESGSGTSPESGDEEVSGAGSSPVSGGVNLFA NDGSFLELFKRKMEEEQRQRQEEPPPGPQRPDQSAAAAGPGDPKRKGGPGSTLSFVGKRR GGNKLALKTGIVAKKQKTEDEVLTSKGDAWAKYMAEVKKYKAHQCGDDDKTRPLVK
Function	Exoribonuclease that is part of the telomerase RNA 3' end processing complex and which has the ability to all four unpaired RNA nucleotides from 5' end or 3' end with higher efficiency for purine bases.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Telomerase RNA component interacting RNase (TRIR).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Telomerase RNA component interacting RNase (TRIR).	[2]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Telomerase RNA component interacting RNase (TRIR).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Telomerase RNA component interacting RNase (TRIR).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Telomerase RNA component interacting RNase (TRIR).	[5]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Telomerase RNA component interacting RNase (TRIR).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Telomerase RNA component interacting RNase (TRIR).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Telomerase RNA component interacting RNase (TRIR).	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

References

1	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
2	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
3	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
6	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
7	Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
8	A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.