Details of the Drug Reposition

General Information of This Drug (ID: DMP9TWZ)

Drug Name
Corticotropin   DMP9TWZ
Synonyms
corticotropin; ACTH; Cortrophin; Corticotrophin; Adrenocorticotropic hormone; Corticotrophine; Corticotrofina; Acthargel; Corticotrophinum; beta-Corticotropin; Adrenocorticotrophin; Purified Cortrophin gel; Corticotropin [USP:INN]; 9002-60-2; CHEBI:3892; BDBM82408; ACTH-(1-39); 25-Asp-30-Gln-corticotropin porcine; NCGC00167127-01; CAS_12279-41-3; Adrenocorticotropic Hormone (1-39), human; LS-187380; SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF; J-004856; alpha1-39-Corticotropin (swine), 25-L-aspartic acid-30-L-glutamine
Structure
3D MOL is unavailable 2D MOL

Information on Drug Reposition of This Drug

Molecular Interaction Atlas (MIA)
3 Approved Indication(s)
Indication Name Indication ID ICD-11 Status REF
West syndrome DISLIAU9 N.A. Approved [1]
Cushing disease DISOG6P2 5A70 Approved [2]
Diabetic nephropathy DIS2FCCT GB61.Z Approved [3]
------------------------------------------------------------------------------------
1 Withdrawn Indication(s)
Indication Name Indication ID ICD-11 Status REF
Stevens-Johnson syndrome DISZG4YX N.A. Withdrawn [4]
------------------------------------------------------------------------------------

References

1 Corticotropin FDA Label
2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3633).
3 ClinicalTrials.gov (NCT01939132) Protocol for H.P. Acthar Gel in Moderately to Severely Active Psoriatic Arthritis. U.S. National Institutes of Health.
4 Treatment Study for Ischemic Optic Neuropathy With Opthalmic Timolol Maleate 0.5%