Details of the Drug

General Information of Drug (ID: DMP9TWZ)

Drug Name
Corticotropin
Synonyms
corticotropin; ACTH; Cortrophin; Corticotrophin; Adrenocorticotropic hormone; Corticotrophine; Corticotrofina; Acthargel; Corticotrophinum; beta-Corticotropin; Adrenocorticotrophin; Purified Cortrophin gel; Corticotropin [USP:INN]; 9002-60-2; CHEBI:3892; BDBM82408; ACTH-(1-39); 25-Asp-30-Gln-corticotropin porcine; NCGC00167127-01; CAS_12279-41-3; Adrenocorticotropic Hormone (1-39), human; LS-187380; SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF; J-004856; alpha1-39-Corticotropin (swine), 25-L-aspartic acid-30-L-glutamine
Indication
Disease Entry ICD 11 Status REF
Cushing disease 5A70 Approved [1]
Diabetic nephropathy GB61.Z Approved [2]
West syndrome N.A. Approved [3]
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
Structure
3D MOL is unavailable 2D MOL
#Ro5 Violations (Lipinski): 5 Molecular Weight (mw) 4541
Logarithm of the Partition Coefficient (xlogp) -19.7
Rotatable Bond Count (rotbonds) 148
Hydrogen Bond Donor Count (hbonddonor) 63
Hydrogen Bond Acceptor Count (hbondacc) 68
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 15 minutes [4]
Chemical Identifiers
Formula
C207H308N56O58S
IUPAC Name
(4S)-4-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-4-amino-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-6-amino-2-[[2-[[(2S)-2-[[(2S)-1-[(2S)-6-amino-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-amino-3-hydroxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-hydroxypropanoyl]amino]-4-methylsulfanylbutanoyl]amino]-4-carboxybutanoyl]amino]-3-(1H-imidazol-5-yl)propanoyl]amino]-3-phenylpropanoyl]amino]-5-carbamimidamidopentanoyl]amino]-3-(1H-indol-3-yl)propanoyl]amino]acetyl]amino]hexanoyl]pyrrolidine-2-carbonyl]amino]-3-methylbutanoyl]amino]acetyl]amino]hexanoyl]amino]hexanoyl]amino]-5-carbamimidamidopentanoyl]amino]-5-carbamimidamidopentanoyl]pyrrolidine-2-carbonyl]amino]-3-methylbutanoyl]amino]hexanoyl]amino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]pyrrolidine-2-carbonyl]amino]-4-oxobutanoyl]amino]acetyl]amino]propanoyl]amino]-4-carboxybutanoyl]amino]-3-carboxypropanoyl]amino]-4-carboxybutanoyl]amino]-3-hydroxypropanoyl]amino]propanoyl]amino]-5-[[(2S)-1-[[(2S)-1-[(2S)-2-[[(2S)-1-[[(2S)-4-carboxy-1-[[(1S)-1-carboxy-2-phenylethyl]amino]-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-1-oxo-3-phenylpropan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-oxopentanoic acid
Canonical SMILES
C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N2CCC[C@H]2C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC3=CC=CC=C3)C(=O)O)NC(=O)CNC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]4CCCN4C(=O)[C@H](CC5=CC=C(C=C5)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C(C)C)NC(=O)[C@@H]6CCCN6C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](C(C)C)NC(=O)[C@@H]7CCCN7C(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC8=CNC9=CC=CC=C98)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](CO)N
InChI
InChI=1S/C207H308N56O58S/c1-108(2)89-140(186(302)240-135(69-74-163(279)280)182(298)254-149(204(320)321)94-117-43-20-15-21-44-117)250-193(309)152-54-35-86-262(152)202(318)147(92-116-41-18-14-19-42-116)252-171(287)114(11)230-175(291)132(66-71-160(273)274)234-170(286)113(10)231-191(307)150(105-265)255-183(299)136(70-75-164(281)282)241-190(306)146(98-165(283)284)249-180(296)133(67-72-161(275)276)235-169(285)112(9)229-157(270)101-225-174(290)145(97-156(213)269)251-194(310)153-55-36-87-263(153)203(319)148(93-119-60-64-123(268)65-61-119)253-199(315)167(110(5)6)257-185(301)129(49-26-30-79-210)243-198(314)168(111(7)8)259-196(312)155-57-38-85-261(155)201(317)139(53-34-83-223-207(218)219)244-178(294)130(51-32-81-221-205(214)215)237-177(293)128(48-25-29-78-209)236-176(292)127(47-24-28-77-208)232-158(271)103-227-197(313)166(109(3)4)258-195(311)154-56-37-84-260(154)200(316)138(50-27-31-80-211)233-159(272)102-226-173(289)143(95-120-99-224-126-46-23-22-45-124(120)126)247-179(295)131(52-33-82-222-206(216)217)238-187(303)142(90-115-39-16-13-17-40-115)246-189(305)144(96-121-100-220-107-228-121)248-181(297)134(68-73-162(277)278)239-184(300)137(76-88-322-12)242-192(308)151(106-266)256-188(304)141(245-172(288)125(212)104-264)91-118-58-62-122(267)63-59-118/h13-23,39-46,58-65,99-100,107-114,125,127-155,166-168,224,264-268H,24-38,47-57,66-98,101-106,208-212H2,1-12H3,(H2,213,269)(H,220,228)(H,225,290)(H,226,289)(H,227,313)(H,229,270)(H,230,291)(H,231,307)(H,232,271)(H,233,272)(H,234,286)(H,235,285)(H,236,292)(H,237,293)(H,238,303)(H,239,300)(H,240,302)(H,241,306)(H,242,308)(H,243,314)(H,244,294)(H,245,288)(H,246,305)(H,247,295)(H,248,297)(H,249,296)(H,250,309)(H,251,310)(H,252,287)(H,253,315)(H,254,298)(H,255,299)(H,256,304)(H,257,301)(H,258,311)(H,259,312)(H,273,274)(H,275,276)(H,277,278)(H,279,280)(H,281,282)(H,283,284)(H,320,321)(H4,214,215,221)(H4,216,217,222)(H4,218,219,223)/t112-,113-,114-,125-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,166-,167-,168-/m0/s1
InChIKey
IDLFZVILOHSSID-OVLDLUHVSA-N
Cross-matching ID
PubChem CID
16132265
ChEBI ID
CHEBI:3892
CAS Number
12427-33-7
DrugBank ID
DB01285
TTD ID
D0R4HQ
INTEDE ID
DR0383
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug-Metabolizing Enzyme (DME)
DME Name DME ID UniProt ID MOA REF
Cytochrome P450 3A4 (CYP3A4)
Main DME 		DE4LYSA CP3A4_HUMAN Substrate [5]

Drug Off-Target (DOT)
DOT Name DOT ID UniProt ID Interaction REF
Adenosine deaminase (ADA) OTOX2872 ADA_HUMAN Gene/Protein Processing [6]
Glucocorticoid receptor (NR3C1) OTCI2YDI GCR_HUMAN Regulation of Drug Effects [7]
Steroid 17-alpha-hydroxylase/17,20 lyase (CYP17A1) OTZKVLVJ CP17A_HUMAN Regulation of Drug Effects [8]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Corticotropin (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Levalbuterol DM5YBO1 Minor Increased risk of hypokalemia by the combination of Corticotropin and Levalbuterol. Asthma [CA23] [9]
Pirbuterol DMI5678 Minor Increased risk of hypokalemia by the combination of Corticotropin and Pirbuterol. Asthma [CA23] [10]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Corticotropin and Roflumilast. Asthma [CA23] [11]
Vilanterol DMF5EK1 Minor Increased risk of hypokalemia by the combination of Corticotropin and Vilanterol. Chronic obstructive pulmonary disease [CA22] [9]
Indacaterol DMQJHR7 Minor Increased risk of hypokalemia by the combination of Corticotropin and Indacaterol. Chronic obstructive pulmonary disease [CA22] [10]
Teriflunomide DMQ2FKJ Major Additive immunosuppressive effects by the combination of Corticotropin and Teriflunomide. Hyper-lipoproteinaemia [5C80] [12]
Amobarbital DM0GQ8N Moderate Increased metabolism of Corticotropin caused by Amobarbital mediated induction of CYP450 enzyme. Insomnia [7A00-7A0Z] [13]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Corticotropin and Denosumab. Low bone mass disorder [FB83] [14]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Corticotropin and Tecfidera. Multiple sclerosis [8A40] [15]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Corticotropin and Siponimod. Multiple sclerosis [8A40] [9]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Corticotropin and Fingolimod. Multiple sclerosis [8A40] [16]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Corticotropin and Ocrelizumab. Multiple sclerosis [8A40] [17]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Corticotropin and Ozanimod. Multiple sclerosis [8A40] [11]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Corticotropin and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [18]
Canakinumab DM8HLO5 Moderate Additive immunosuppressive effects by the combination of Corticotropin and Canakinumab. Rheumatoid arthritis [FA20] [19]
Rilonacept DMGLUQS Moderate Additive immunosuppressive effects by the combination of Corticotropin and Rilonacept. Rheumatoid arthritis [FA20] [19]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Corticotropin and Golimumab. Rheumatoid arthritis [FA20] [20]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Corticotropin when combined with Anthrax vaccine. Sepsis [1G40-1G41] [21]
⏷ Show the Full List of 18 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 3633).
2 ClinicalTrials.gov (NCT01939132) Protocol for H.P. Acthar Gel in Moderately to Severely Active Psoriatic Arthritis. U.S. National Institutes of Health.
3 Corticotropin FDA Label
4 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
5 Troglitazone induces CYP3A4 activity leading to falsely abnormal dexamethasone suppression test. J Clin Endocrinol Metab. 2003 Jul;88(7):3113-6.
6 Activity of adenosine deaminase in red blood cells of patients suffering from multiple sclerosis treated with adrenocorticotropic hormone. Pol J Pharmacol. 1995 Nov-Dec;47(6):525-30.
7 Sex specific associations between common glucocorticoid receptor gene variants and hypothalamus-pituitary-adrenal axis responses to psychosocial stress. Biol Psychiatry. 2007 Oct 15;62(8):863-9. doi: 10.1016/j.biopsych.2007.04.013. Epub 2007 Aug 23.
8 Partial 17alpha-hydroxylase/17,20-lyase deficiency-clinical report of five Chinese 46,XX cases. Gynecol Endocrinol. 2008 Jul;24(7):362-7. doi: 10.1080/09513590802194051.
9 Cerner Multum, Inc. "Australian Product Information.".
10 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
11 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
12 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
13 Bartoszek M, Brenner AM, Szefler SJ "Prednisolone and methylprednisolone kinetics in children receiving anticonvulsant therapy." Clin Pharmacol Ther 42 (1987): 424-32. [PMID: 3665340]
14 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
15 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
16 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
17 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
18 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
19 Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
20 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
21 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]