Details of the Drug
General Information of Drug (ID: DMG9HIA)
Drug Name |
Urofollitropin
|
||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms |
Bravelle; Fertinex; Metrodin; Urofollitrophin; Fertinorm HP; Bravelle (TN); Fertinex (TN); Follistim (TN); Gonal-F(TN); (4-Threonine)oxytocin; 1,2-Dithia-5,8,11,14,17-penaazacycloeicosane, cyclic peptide deriv.; 4-(L-Threonine)oxytocin
|
||||||||||||||||||||||
Indication |
|
||||||||||||||||||||||
Therapeutic Class |
Fertility Agents
|
||||||||||||||||||||||
Drug Type |
Small molecular drug
|
||||||||||||||||||||||
Sequence |
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS >Beta chain NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYET VRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
||||||||||||||||||||||
Structure | |||||||||||||||||||||||
3D MOL | 2D MOL | ||||||||||||||||||||||
#Ro5 Violations (Lipinski): 4 | Molecular Weight (mw) | 980.2 | |||||||||||||||||||||
Logarithm of the Partition Coefficient (xlogp) | -1.5 | ||||||||||||||||||||||
Rotatable Bond Count (rotbonds) | 15 | ||||||||||||||||||||||
Hydrogen Bond Donor Count (hbonddonor) | 12 | ||||||||||||||||||||||
Hydrogen Bond Acceptor Count (hbondacc) | 15 | ||||||||||||||||||||||
ADMET Property |
|
||||||||||||||||||||||
Chemical Identifiers |
|
||||||||||||||||||||||
Cross-matching ID | |||||||||||||||||||||||
Molecular Interaction Atlas of This Drug
Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
The Studied Disease | Female infertility | |||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
ICD Disease Classification | GA31.Z | |||||||||||||||||||||||
|
||||||||||||||||||||||||
Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||
Drug Inactive Ingredient(s) (DIG) and Formulation(s) of This Drug
References
1 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | ||||
---|---|---|---|---|---|
2 | Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds | ||||
3 | Follicle-stimulating hormone in clinical practice: an update. Treat Endocrinol. 2004;3(3):161-71. | ||||