Details of the Drug
General Information of Drug (ID: DMG9HIA)
Drug Name |
Urofollitropin
|
|||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms |
Bravelle; Fertinex; Metrodin; Urofollitrophin; Fertinorm HP; Bravelle (TN); Fertinex (TN); Follistim (TN); Gonal-F(TN); (4-Threonine)oxytocin; 1,2-Dithia-5,8,11,14,17-penaazacycloeicosane, cyclic peptide deriv.; 4-(L-Threonine)oxytocin
|
|||||||||||||||||||
Indication |
|
|||||||||||||||||||
Therapeutic Class |
Fertility Agents
|
|||||||||||||||||||
Drug Type |
Small molecular drug
|
|||||||||||||||||||
Sequence |
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS >Beta chain NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYET VRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
|||||||||||||||||||
Structure | ||||||||||||||||||||
3D MOL | 2D MOL | |||||||||||||||||||
#Ro5 Violations (Lipinski): 4 | Molecular Weight (mw) | 980.2 | ||||||||||||||||||
Topological Polar Surface Area (xlogp) | -1.5 | |||||||||||||||||||
Rotatable Bond Count (rotbonds) | 15 | |||||||||||||||||||
Hydrogen Bond Donor Count (hbonddonor) | 12 | |||||||||||||||||||
Hydrogen Bond Acceptor Count (hbondacc) | 15 | |||||||||||||||||||
ADMET Property | ||||||||||||||||||||
Chemical Identifiers |
|
|||||||||||||||||||
Cross-matching ID | ||||||||||||||||||||
Molecular Interaction Atlas of This Drug
Drug Therapeutic Target (DTT) |
|
||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||
Molecular Expression Atlas of This Drug
The Studied Disease | Female infertility | |||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
ICD Disease Classification | GA31.Z | |||||||||||||||||||||||
|
||||||||||||||||||||||||
Molecular Expression Atlas (MEA) | ||||||||||||||||||||||||
Drug Inactive Ingredient(s) (DIG) and Formulation(s) of This Drug
References
1 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | ||||
---|---|---|---|---|---|
2 | FDA approval: ado-trastuzumab emtansine for the treatment of patients with HER2-positive metastatic breast cancer. Clin Cancer Res. 2014 Sep 1;20(17):4436-41. | ||||
3 | An FDA phase I clinical trial of quinacrine sterilization (QS). Int J Gynaecol Obstet. 2003 Oct;83 Suppl 2:S45-9. | ||||
4 | Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds | ||||
5 | Follicle-stimulating hormone in clinical practice: an update. Treat Endocrinol. 2004;3(3):161-71. | ||||
6 | The role of gonadotropins in ovulation induction. Am J Obstet Gynecol. 1995 Feb;172(2 Pt 2):759-65. | ||||
7 | Follitropin-alpha (Gonal-F) versus follitropin-beta (Puregon) in controlled ovarian hyperstimulation for in vitro fertilization: is there any diffe... Fertil Steril. 2009 Apr;91(4 Suppl):1522-5. | ||||
8 | Suramin: clinical uses and structure-activity relationships. Mini Rev Med Chem. 2008 Nov;8(13):1384-94. | ||||
9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 253). | ||||
10 | A naturally occurring basically charged human follicle-stimulating hormone (FSH) variant inhibits FSH-induced androgen aromatization and tissue-type plasminogen activator enzyme activity in vitro. Neuroendocrinology. 1998 Mar;67(3):153-63. | ||||