Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT1BO38)

DTP Name Zinc transporter 1 (SLC30A1)
Gene Name SLC30A1
UniProt ID
Q9Y6M5 (ZNT1_HUMAN)
VARIDT ID
DTD0269
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC30A1; Solute carrier family 30 member 1; ZNT1; ZRC1; ZnT-1
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Sequence
MGCWGRNRGRLLCMLALTFMFMVLEVVVSRVTSSLAMLSDSFHMLSDVLALVVALVAERF
ARRTHATQKNTFGWIRAEVMGALVNAIFLTGLCFAILLEAIERFIEPHEMQQPLVVLGVG
VAGLLVNVLGLCLFHHHSGFSQDSGHGHSHGGHGHGHGLPKGPRVKSTRPGSSDINVAPG
EQGPDQEETNTLVANTSNSNGLKLDPADPENPRSGDTVEVQVNGNLVREPDHMELEEDRA
GQLNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCSEGDFCVNPCFPDPCKAFVEIINS
THASVYEAGPCWVLYLDPTLCVVMVCILLYTTYPLLKESALILLQTVPKQIDIRNLIKEL
RNVEGVEEVHELHVWQLAGSRIIATAHIKCEDPTSYMEVAKTIKDVFHNHGIHATTIQPE
FASVGSKSSVVPCELACRTQCALKQCCGTLPQAPSGKDAEKTPAVSISCLELSNNLEKKP
RRTKAENIPAVVIEIKNMPNKQPESSL
Function This transporter may be involved in zinc transport out of the cell.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.2.6
Gene ID
7779
KEGG Pathway
Mineral absorption (hsa04978 )
Reactome Pathway
Zinc efflux and compartmentalization by the SLC30 family (R-HSA-435368 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.53E-09 8.64E-01 8.36E-01
Adrenocortical carcinoma 2D11.Z Kidney 8.29E-01 -5.20E-02 -9.93E-02
Alopecia ED70 Skin from scalp 6.25E-02 -6.20E-02 -2.27E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.49E-01 -5.74E-02 -1.56E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.86E-01 2.93E-01 7.46E-01
Aortic stenosis BB70 Calcified aortic valve 9.47E-01 -4.18E-02 -4.73E-02
Apnea 7A40 Hyperplastic tonsil 3.03E-02 -4.07E-01 -1.39E+00
Arthropathy FA00-FA5Z Peripheral blood 7.48E-01 -2.37E-02 -7.37E-02
Asthma CA23 Nasal and bronchial airway 6.93E-05 -2.36E-01 -3.83E-01
Atopic dermatitis EA80 Skin 2.67E-04 -7.29E-01 -1.77E+00
Autism 6A02 Whole blood 3.12E-01 1.87E-01 3.88E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.11E-02 -2.32E+00 -2.76E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.47E-01 6.49E-01 1.28E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.85E-05 -2.40E-01 -6.79E-01
Batten disease 5C56.1 Whole blood 6.64E-01 1.06E-01 2.73E-01
Behcet's disease 4A62 Peripheral blood 2.64E-01 9.33E-02 1.98E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.79E-01 -2.76E-02 -1.14E-01
Bladder cancer 2C94 Bladder tissue 3.33E-01 -4.29E-01 -1.11E+00
Breast cancer 2C60-2C6Z Breast tissue 2.66E-41 6.14E-01 9.75E-01
Cardioembolic stroke 8B11.20 Whole blood 4.41E-02 2.96E-02 8.33E-02
Cervical cancer 2C77 Cervical tissue 1.89E-01 1.56E-01 3.01E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.59E-01 -7.87E-02 -2.08E-01
Chronic hepatitis C 1E51.1 Whole blood 9.72E-01 8.63E-03 2.52E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 5.33E-01 8.25E-02 6.11E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.98E-02 -1.08E-01 -2.51E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.54E-01 2.11E-02 4.66E-02
Colon cancer 2B90 Colon tissue 9.87E-02 -8.20E-02 -1.29E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.79E-02 1.18E-01 1.02E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.61E-01 1.56E-01 3.46E-01
Endometriosis GA10 Endometrium tissue 4.20E-02 4.86E-01 6.78E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.63E-01 -5.29E-02 -1.98E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.20E-07 1.28E+00 1.80E+00
Gastric cancer 2B72 Gastric tissue 7.17E-02 1.74E+00 1.90E+00
Glioblastopma 2A00.00 Nervous tissue 6.07E-50 5.41E-01 1.00E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.62E-01 8.62E-02 1.28E-01
Head and neck cancer 2D42 Head and neck tissue 3.10E-01 1.34E-01 1.78E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.32E-01 -5.46E-02 -2.90E-01
Huntington's disease 8A01.10 Whole blood 3.92E-01 -1.61E-02 -5.70E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.22E-01 -2.00E-01 -1.27E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.77E-02 1.21E-01 1.22E+00
Influenza 1.00E+30 Whole blood 4.51E-03 -1.79E+00 -3.54E+00
Interstitial cystitis GC00.3 Bladder tissue 7.71E-01 1.60E-01 4.70E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.26E-02 4.69E-01 7.41E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.12E-02 -1.61E-01 -4.10E-01
Ischemic stroke 8B11 Peripheral blood 8.44E-01 -4.57E-02 -1.14E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.31E-04 2.40E-01 5.05E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.90E-01 -6.16E-02 -3.67E-01
Lateral sclerosis 8B60.4 Skin 4.02E-01 -1.48E-01 -2.62E-01
Liver cancer 2C12.0 Liver tissue 6.44E-06 -3.35E-01 -5.56E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.11E-06 -1.82E+00 -3.72E+00
Lung cancer 2C25 Lung tissue 3.27E-19 6.28E-01 8.30E-01
Lupus erythematosus 4A40 Whole blood 1.87E-08 3.14E-01 4.89E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.17E-01 1.86E-01 3.79E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.50E-01 -4.43E-02 -1.86E-01
Melanoma 2C30 Skin 4.33E-03 -3.50E-01 -3.67E-01
Multiple myeloma 2A83.1 Bone marrow 2.16E-05 9.97E-01 3.01E+00
Multiple myeloma 2A83.1 Peripheral blood 6.86E-01 1.46E-01 2.28E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.59E-01 3.68E-02 6.84E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.81E-02 1.67E-01 1.63E-01
Myelofibrosis 2A20.2 Whole blood 2.24E-02 1.25E+00 5.87E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.98E-05 5.62E-01 5.42E-01
Myopathy 8C70.6 Muscle tissue 5.63E-02 5.45E-01 1.15E+00
Neonatal sepsis KA60 Whole blood 2.32E-24 8.06E-01 2.07E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.10E-04 1.25E+00 1.81E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.90E-03 1.11E+00 2.34E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.83E-01 -4.29E-01 -4.79E-01
Olive pollen allergy CA08.00 Peripheral blood 8.40E-01 -2.30E-01 -2.41E-01
Oral cancer 2B6E Oral tissue 2.93E-11 9.63E-01 1.68E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.36E-02 1.31E+00 1.60E+00
Osteoporosis FB83.1 Bone marrow 1.72E-01 -5.88E-01 -1.21E+00
Ovarian cancer 2C73 Ovarian tissue 7.90E-03 7.29E-01 1.11E+00
Pancreatic cancer 2C10 Pancreas 7.96E-04 3.53E-01 7.19E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.33E-01 -7.93E-02 -1.16E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.00E-05 1.02E+00 1.60E+00
Pituitary cancer 2D12 Pituitary tissue 1.57E-06 1.04E+00 2.33E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.40E-06 1.72E+00 3.30E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.82E-01 -6.88E-03 -4.59E-02
Polycythemia vera 2A20.4 Whole blood 1.35E-05 2.31E-01 1.17E+00
Pompe disease 5C51.3 Biceps muscle 2.77E-01 1.63E-01 2.52E-01
Preterm birth KA21.4Z Myometrium 8.65E-01 2.39E-01 3.84E-01
Prostate cancer 2C82 Prostate 1.67E-03 9.59E-01 8.36E-01
Psoriasis EA90 Skin 2.23E-05 4.35E-01 6.85E-01
Rectal cancer 2B92 Rectal colon tissue 7.38E-02 -2.97E-01 -1.10E+00
Renal cancer 2C90-2C91 Kidney 1.24E-01 8.37E-01 9.23E-01
Retinoblastoma 2D02.2 Uvea 1.36E-01 9.39E-03 2.71E-02
Rheumatoid arthritis FA20 Synovial tissue 1.20E-07 1.17E+00 3.53E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.37E-01 -2.67E-02 -1.21E-01
Schizophrenia 6A20 Prefrontal cortex 7.63E-02 1.06E-01 1.45E-01
Schizophrenia 6A20 Superior temporal cortex 3.70E-01 6.40E-02 5.45E-01
Scleroderma 4A42.Z Whole blood 2.01E-06 7.06E-01 2.78E+00
Seizure 8A60-8A6Z Whole blood 4.03E-01 -2.11E-01 -3.98E-01
Sensitive skin EK0Z Skin 6.24E-01 -1.60E-01 -5.07E-01
Sepsis with septic shock 1G41 Whole blood 3.73E-28 5.51E-01 1.28E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.76E-01 -1.04E-01 -1.55E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.86E-01 7.67E-02 3.99E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.05E-01 -9.00E-02 -2.58E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.23E-01 -1.02E-01 -4.10E-01
Skin cancer 2C30-2C3Z Skin 1.41E-07 -5.07E-01 -6.87E-01
Thrombocythemia 3B63 Whole blood 9.01E-01 -2.27E-02 -1.08E-01
Thrombocytopenia 3B64 Whole blood 8.07E-01 -2.69E-01 -3.46E-01
Thyroid cancer 2D10 Thyroid 2.37E-03 -1.18E-01 -2.59E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.44E-05 6.44E-01 1.71E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.38E-02 2.23E-01 9.27E-01
Type 2 diabetes 5A11 Liver tissue 1.54E-03 5.74E-01 3.09E+00
Ureter cancer 2C92 Urothelium 6.38E-01 -1.02E-03 -8.00E-03
Uterine cancer 2C78 Endometrium tissue 5.68E-01 -2.14E-01 -2.97E-01
Vitiligo ED63.0 Skin 9.42E-01 4.87E-02 1.57E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Zinc transporters ZnT1 (Slc30a1), Zip8 (Slc39a8), and Zip10 (Slc39a10) in mouse red blood cells are differentially regulated during erythroid development and by dietary zinc deficiency. J Nutr. 2008 Nov;138(11):2076-83.