Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT1UIT5)

DTP Name Zinc transporter ZIP12 (SLC39A12)
Gene Name SLC39A12
UniProt ID
Q504Y0 (S39AC_HUMAN)
VARIDT ID
DTD0340
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms LIV-1 subfamily of ZIP zinc transporter 8; LZT-Hs8; SLC39A12; Solute carrier family 39 member 12; ZIP-12; ZIP12; Zinc transporter ZIP12; bA570F3.1
DTP Family Zinc (Zn(2+))-Iron (Fe(2+)) Permease (ZIP) Family ;
Tissue Specificity Expressed in brain and eye.
Sequence
MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNH
SRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLY
YIIHQEEICSSKLNMSNKEYKFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQS
QCMETKTLQKKSGIVSSEGANESTLPQLAAMIITLSLQGVCLGQGNLPSPDYFTEYIFSS
LNRTNTLRLSELDQLLNTLWTRSTCIKNEKIHQFQRKQNNIITHDQDYSNFSSSMEKESE
DGPVSWDQTCFSARQLVEIFLQKGLSLISKEDFKQMSPGIIQQLLSCSCHLPKDQQAKLP
PTTLEKYGYSTVAVTLLTLGSMLGTALVLFHSCEENYRLILQLFVGLAVGTLSGDALLHL
IPQVLGLHKQEAPEFGHFHESKGHIWKLMGLIGGIHGFFLIEKCFILLVSPNDKQGLSLV
NGHVGHSHHLALNSELSDQAGRGKSASTIQLKSPEDSQAAEMPIGSMTASNRKCKAISLL
AIMILVGDSLHNFADGLAIGAAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMK
TAILMNFISSLTAFMGLYIGLSVSADPCVQDWIFTVTAGMFLYLSLVEMLPEMTHVQTQR
PWMMFLLQNFGLILGWLSLLLLAIYEQNIKI
Function This transporter mediates the influx of zinc.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.5.4.14
Gene ID
221074
KEGG Pathway
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.27E-02 -2.35E-03 -1.89E-02
Adrenocortical carcinoma 2D11.Z Kidney 9.48E-01 3.71E-03 2.98E-02
Alopecia ED70 Skin from scalp 4.07E-01 6.02E-02 1.24E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.25E-10 6.12E-01 5.43E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.08E-01 9.53E-02 8.31E-01
Aortic stenosis BB70 Calcified aortic valve 2.85E-01 1.36E-01 6.19E-01
Apnea 7A40 Hyperplastic tonsil 8.12E-01 1.96E-02 1.08E-01
Arthropathy FA00-FA5Z Peripheral blood 5.20E-01 6.31E-03 6.01E-02
Asthma CA23 Nasal and bronchial airway 9.07E-01 -1.55E-03 -5.55E-03
Atopic dermatitis EA80 Skin 2.87E-06 1.76E-01 1.75E+00
Autism 6A02 Whole blood 9.38E-01 5.68E-03 5.71E-02
Autoimmune uveitis 9A96 Peripheral monocyte 1.60E-01 -5.78E-02 -3.80E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.35E-01 1.02E-01 9.76E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.43E-01 -1.82E-02 -1.34E-01
Batten disease 5C56.1 Whole blood 7.34E-01 3.73E-02 4.43E-01
Behcet's disease 4A62 Peripheral blood 9.71E-01 -7.19E-02 -5.66E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.32E-02 1.29E-01 2.04E-01
Bladder cancer 2C94 Bladder tissue 2.05E-02 1.62E-01 9.76E-01
Breast cancer 2C60-2C6Z Breast tissue 4.94E-02 -9.80E-02 -2.55E-01
Cardioembolic stroke 8B11.20 Whole blood 9.61E-01 1.74E-02 6.91E-02
Cervical cancer 2C77 Cervical tissue 1.05E-02 -1.28E-01 -8.49E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.72E-01 1.67E-02 1.16E-01
Chronic hepatitis C 1E51.1 Whole blood 3.52E-01 -1.03E-01 -6.61E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.57E-01 -3.10E-02 -1.89E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.29E-02 3.67E-02 3.64E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.48E-01 7.68E-03 9.90E-02
Colon cancer 2B90 Colon tissue 9.79E-01 7.65E-04 5.01E-03
Coronary artery disease BA80-BA8Z Peripheral blood 6.23E-01 -8.04E-03 -6.65E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.83E-01 -3.48E-02 -3.36E-02
Endometriosis GA10 Endometrium tissue 6.00E-01 1.76E-02 1.55E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.07E-01 -8.77E-03 -5.39E-02
Familial hypercholesterolemia 5C80.00 Whole blood 3.72E-02 -7.30E-02 -5.57E-01
Gastric cancer 2B72 Gastric tissue 3.07E-01 -3.79E-02 -5.68E-01
Glioblastopma 2A00.00 Nervous tissue 4.13E-57 -2.28E+00 -1.55E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.08E-01 -6.38E-01 -1.64E+00
Head and neck cancer 2D42 Head and neck tissue 3.81E-01 1.12E-02 9.00E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.17E-01 7.63E-01 7.59E-01
Huntington's disease 8A01.10 Whole blood 6.39E-01 2.06E-02 3.32E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.26E-01 -1.39E-01 -7.99E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.00E-01 1.68E-02 1.02E-01
Influenza 1.00E+30 Whole blood 5.52E-01 -1.25E-01 -7.20E-01
Interstitial cystitis GC00.3 Bladder tissue 6.18E-03 8.84E-02 2.53E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.58E-03 2.07E-01 1.34E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.94E-01 2.52E-01 4.89E-01
Ischemic stroke 8B11 Peripheral blood 9.48E-01 4.42E-03 1.96E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.84E-01 2.80E-02 7.10E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 4.97E-02 1.72E-01 5.56E-01
Lateral sclerosis 8B60.4 Skin 4.53E-01 8.50E-02 7.17E-01
Liver cancer 2C12.0 Liver tissue 2.38E-01 -4.54E-02 -2.63E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.41E-01 -9.83E-02 -8.28E-01
Lung cancer 2C25 Lung tissue 2.25E-02 1.19E-02 8.78E-02
Lupus erythematosus 4A40 Whole blood 2.43E-09 8.17E-02 4.56E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.56E-01 1.90E-02 7.07E-02
Major depressive disorder 6A70-6A7Z Hippocampus 4.96E-01 -1.01E-01 -1.58E-01
Melanoma 2C30 Skin 1.58E-01 -6.09E-02 -8.31E-02
Multiple myeloma 2A83.1 Bone marrow 1.10E-01 -1.31E-01 -8.68E-01
Multiple myeloma 2A83.1 Peripheral blood 2.98E-02 2.81E-02 3.52E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.40E-02 -1.92E-01 -1.28E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.97E-03 5.27E-02 4.62E-01
Myelofibrosis 2A20.2 Whole blood 6.45E-01 -2.52E-02 -2.34E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.63E-01 -4.95E-02 -4.88E-02
Myopathy 8C70.6 Muscle tissue 8.47E-01 1.13E-02 4.41E-02
Neonatal sepsis KA60 Whole blood 1.35E-03 3.96E-02 3.14E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.08E-02 -1.59E+00 -1.60E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.48E-01 -1.00E-01 -1.08E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.05E-02 7.37E-02 1.21E+00
Olive pollen allergy CA08.00 Peripheral blood 8.31E-01 -1.73E-02 -2.50E-01
Oral cancer 2B6E Oral tissue 8.54E-01 2.34E-02 1.03E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.19E-01 2.10E-02 9.58E-02
Osteoporosis FB83.1 Bone marrow 5.14E-02 3.74E-01 5.60E+00
Ovarian cancer 2C73 Ovarian tissue 1.23E-01 -1.66E-01 -9.44E-01
Pancreatic cancer 2C10 Pancreas 1.36E-02 -1.10E-01 -5.31E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.94E-01 4.42E-01 7.65E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.50E-01 4.71E-02 4.06E-01
Pituitary cancer 2D12 Pituitary tissue 8.30E-04 -1.19E+00 -1.08E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.20E-04 -2.24E+00 -2.26E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.64E-01 2.94E-02 3.70E-01
Polycythemia vera 2A20.4 Whole blood 7.99E-09 1.27E-01 1.38E+00
Pompe disease 5C51.3 Biceps muscle 2.50E-03 -2.43E-01 -1.45E+00
Preterm birth KA21.4Z Myometrium 8.74E-01 -5.82E-02 -3.66E-01
Prostate cancer 2C82 Prostate 6.22E-02 1.64E-01 3.95E-01
Psoriasis EA90 Skin 4.44E-04 7.03E-02 4.06E-01
Rectal cancer 2B92 Rectal colon tissue 3.23E-01 -7.70E-02 -3.81E-01
Renal cancer 2C90-2C91 Kidney 4.29E-06 1.37E-01 1.37E+00
Retinoblastoma 2D02.2 Uvea 4.15E-10 -5.41E+00 -8.08E+00
Rheumatoid arthritis FA20 Synovial tissue 7.00E-01 -1.44E-01 -5.70E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.22E-01 1.66E-02 1.53E-01
Schizophrenia 6A20 Prefrontal cortex 4.97E-01 7.18E-02 3.39E-02
Schizophrenia 6A20 Superior temporal cortex 5.42E-01 4.43E-01 5.13E-01
Scleroderma 4A42.Z Whole blood 1.24E-02 1.22E-01 1.01E+00
Seizure 8A60-8A6Z Whole blood 3.39E-01 -2.45E-02 -1.55E-01
Sensitive skin EK0Z Skin 2.21E-01 -1.21E-01 -6.15E-01
Sepsis with septic shock 1G41 Whole blood 3.48E-06 3.33E-02 2.56E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.00E-03 1.71E-01 1.16E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.08E-01 8.05E-02 5.81E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.26E-01 -4.34E-02 -4.01E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.69E-01 -5.70E-03 -4.19E-02
Skin cancer 2C30-2C3Z Skin 1.95E-15 1.70E-01 6.52E-01
Thrombocythemia 3B63 Whole blood 1.30E-02 7.17E-02 7.41E-01
Thrombocytopenia 3B64 Whole blood 4.00E-02 -4.21E-02 -5.61E-01
Thyroid cancer 2D10 Thyroid 2.10E-06 6.89E-02 3.99E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.78E-01 2.04E-02 2.14E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.75E-02 6.58E-01 1.81E+00
Type 2 diabetes 5A11 Liver tissue 1.87E-01 -5.11E-02 -6.59E-01
Ureter cancer 2C92 Urothelium 4.95E-01 9.50E-02 3.85E-01
Uterine cancer 2C78 Endometrium tissue 1.81E-01 -2.46E-02 -1.24E-01
Vitiligo ED63.0 Skin 9.41E-01 -1.04E-02 -1.15E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The zinc transporter ZIP12 regulates the pulmonary vascular response to chronic hypoxia. Nature. 2015 Aug 20;524(7565):356-60.