Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT280XI)

DTP Name Zinc transporter 4 (SLC30A4)
Gene Name SLC30A4
UniProt ID
O14863 (ZNT4_HUMAN)
VARIDT ID
DTD0273
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC30A4; Solute carrier family 30 member 4; ZNT4; ZnT-4
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Sequence
MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPER
PVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL
YLLFMIGELVGGYIANSLAIMTDALHMLTDLSAIILTLLALWLSSKSPTKRFTFGFHRLE
VLSAMISVLLVYILMGFLLYEAVQRTIHMNYEINGDIMLITAAVGVAVNVIMGFLLNQSG
HRHSHSHSLPSNSPTRGSGCERNHGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKPE
YKIADPICTYVFSLLVAFTTFRIIWDTVVIILEGVPSHLNVDYIKEALMKIEDVYSVEDL
NIWSLTSGKSTAIVHIQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRT
CANCQSSSP
Function This transporter probably involved in zinc transport out of the cytoplasm, maybe by sequestration into an intracellular compartment.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.3.7
Gene ID
7782

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.07E-02 -1.41E-02 -1.03E-01
Adrenocortical carcinoma 2D11.Z Kidney 6.11E-02 3.35E-02 3.20E-01
Alopecia ED70 Skin from scalp 7.55E-01 1.22E-02 6.16E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.22E-01 1.14E-02 3.74E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 5.38E-01 7.81E-02 4.35E-01
Aortic stenosis BB70 Calcified aortic valve 8.89E-01 -7.06E-02 -4.58E-01
Apnea 7A40 Hyperplastic tonsil 6.30E-02 1.37E-01 1.00E+00
Arthropathy FA00-FA5Z Peripheral blood 9.26E-01 2.27E-02 1.43E-01
Asthma CA23 Nasal and bronchial airway 2.14E-04 -1.17E-01 -2.28E-01
Atopic dermatitis EA80 Skin 1.74E-04 1.12E-01 1.00E+00
Autism 6A02 Whole blood 5.10E-01 5.37E-02 2.33E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.02E-01 2.99E-02 2.18E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.34E-01 6.66E-02 3.09E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.25E-04 -8.14E-02 -5.47E-01
Batten disease 5C56.1 Whole blood 5.19E-01 -8.32E-05 -9.60E-04
Behcet's disease 4A62 Peripheral blood 8.07E-02 -9.72E-02 -3.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.81E-01 2.78E-02 1.32E-01
Bladder cancer 2C94 Bladder tissue 2.93E-02 3.03E-02 7.86E-01
Breast cancer 2C60-2C6Z Breast tissue 3.77E-01 -2.13E-02 -9.14E-02
Cardioembolic stroke 8B11.20 Whole blood 7.25E-04 -2.65E-01 -9.32E-01
Cervical cancer 2C77 Cervical tissue 1.36E-01 -9.93E-02 -4.89E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.92E-02 -6.74E-02 -5.03E-01
Chronic hepatitis C 1E51.1 Whole blood 8.87E-01 -1.80E-02 -1.27E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.43E-01 -1.31E-02 -6.62E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.39E-01 1.24E-02 1.02E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.28E-01 4.62E-02 1.22E-01
Colon cancer 2B90 Colon tissue 1.56E-22 -2.85E-01 -9.30E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.00E-01 1.22E-01 1.13E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.02E-01 -3.05E-02 -8.73E-02
Endometriosis GA10 Endometrium tissue 4.67E-01 -1.60E-02 -8.15E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.27E-02 -1.13E-01 -9.93E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.25E-01 -3.30E-02 -2.65E-01
Gastric cancer 2B72 Gastric tissue 9.15E-01 -1.21E-01 -6.38E-01
Glioblastopma 2A00.00 Nervous tissue 3.98E-13 -1.10E-01 -3.13E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.17E-02 8.04E-02 3.15E-01
Head and neck cancer 2D42 Head and neck tissue 5.82E-01 3.72E-02 1.30E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.49E-01 -8.48E-02 -2.07E-01
Huntington's disease 8A01.10 Whole blood 5.35E-01 -6.17E-02 -2.95E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.30E-02 -7.79E-02 -7.10E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.32E-02 -5.64E-02 -4.11E-01
Influenza 1.00E+30 Whole blood 4.59E-01 7.61E-02 4.82E-01
Interstitial cystitis GC00.3 Bladder tissue 1.00E-01 2.72E-02 6.19E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.03E-01 0.00E+00 0.00E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.97E-01 -1.48E-01 -3.31E-01
Ischemic stroke 8B11 Peripheral blood 3.59E-01 -2.08E-02 -1.26E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.30E-01 -3.89E-02 -1.15E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.93E-01 -5.86E-02 -1.95E-01
Lateral sclerosis 8B60.4 Skin 4.89E-02 -3.08E-01 -2.06E+00
Liver cancer 2C12.0 Liver tissue 3.80E-02 -1.25E-01 -5.56E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.52E-02 2.88E-01 1.21E+00
Lung cancer 2C25 Lung tissue 9.25E-01 2.32E-03 1.11E-02
Lupus erythematosus 4A40 Whole blood 4.85E-01 -4.45E-02 -1.93E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.66E-01 -4.29E-02 -1.80E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.96E-01 6.97E-03 3.21E-02
Melanoma 2C30 Skin 1.83E-01 -1.50E-01 -3.59E-01
Multiple myeloma 2A83.1 Bone marrow 5.45E-02 1.16E-01 6.75E-01
Multiple myeloma 2A83.1 Peripheral blood 9.42E-01 -9.13E-03 -3.48E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.38E-01 -3.54E-01 -8.16E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.30E-01 4.75E-02 2.87E-01
Myelofibrosis 2A20.2 Whole blood 2.55E-02 -1.02E-01 -9.17E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.45E-01 9.35E-02 1.79E-01
Myopathy 8C70.6 Muscle tissue 8.97E-01 5.74E-03 3.08E-02
Neonatal sepsis KA60 Whole blood 2.91E-04 -8.42E-02 -4.94E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.24E-02 4.84E-02 3.84E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.70E-01 -5.82E-02 -7.02E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.18E-01 -4.79E-02 -4.57E-01
Olive pollen allergy CA08.00 Peripheral blood 3.74E-01 0.00E+00 0.00E+00
Oral cancer 2B6E Oral tissue 7.95E-01 4.67E-02 2.18E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.22E-01 -8.75E-02 -3.37E-01
Osteoporosis FB83.1 Bone marrow 4.16E-01 2.77E-02 7.36E-01
Ovarian cancer 2C73 Ovarian tissue 1.11E-02 -3.73E-01 -9.54E-01
Pancreatic cancer 2C10 Pancreas 1.91E-01 -1.34E-01 -4.04E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.00E-01 -1.92E-03 -9.79E-03
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.53E-02 -1.72E-01 -7.42E-01
Pituitary cancer 2D12 Pituitary tissue 6.37E-02 -9.44E-02 -4.35E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.51E-02 -2.64E-01 -1.24E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.05E-02 -4.68E-02 -3.70E-01
Polycythemia vera 2A20.4 Whole blood 2.37E-02 -7.36E-02 -7.53E-01
Pompe disease 5C51.3 Biceps muscle 2.06E-01 -5.61E-02 -1.96E-01
Preterm birth KA21.4Z Myometrium 8.86E-01 -1.89E-02 -8.30E-02
Prostate cancer 2C82 Prostate 7.41E-02 3.46E-01 2.30E-01
Psoriasis EA90 Skin 9.22E-06 1.58E-01 5.14E-01
Rectal cancer 2B92 Rectal colon tissue 1.05E-01 -2.79E-01 -1.03E+00
Renal cancer 2C90-2C91 Kidney 2.47E-01 -3.87E-02 -1.67E-01
Retinoblastoma 2D02.2 Uvea 9.68E-01 1.01E-02 6.53E-02
Rheumatoid arthritis FA20 Synovial tissue 3.30E-02 -3.36E-01 -1.53E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.44E-01 1.22E-02 1.34E-01
Schizophrenia 6A20 Prefrontal cortex 5.63E-01 5.37E-03 2.37E-02
Schizophrenia 6A20 Superior temporal cortex 7.36E-01 3.28E-02 3.39E-01
Scleroderma 4A42.Z Whole blood 4.55E-02 8.24E-02 6.44E-01
Seizure 8A60-8A6Z Whole blood 5.42E-01 9.97E-02 5.76E-01
Sensitive skin EK0Z Skin 4.96E-01 -6.94E-02 -3.96E-01
Sepsis with septic shock 1G41 Whole blood 6.02E-02 -2.92E-02 -1.40E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.97E-01 -4.44E-03 -2.25E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.19E-01 -1.90E-04 -1.75E-03
Simpson golabi behmel syndrome LD2C Adipose tissue 9.75E-03 1.75E-01 8.95E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.92E-01 -1.10E-01 -8.38E-01
Skin cancer 2C30-2C3Z Skin 1.26E-02 -3.26E-02 -1.01E-01
Thrombocythemia 3B63 Whole blood 6.70E-01 -3.13E-03 -2.88E-02
Thrombocytopenia 3B64 Whole blood 1.34E-01 -1.07E-01 -6.79E-01
Thyroid cancer 2D10 Thyroid 6.31E-14 -3.41E-01 -9.55E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.00E-01 -9.57E-02 -6.39E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.53E-03 4.98E-01 6.81E+00
Type 2 diabetes 5A11 Liver tissue 9.63E-01 -1.37E-02 -1.19E-01
Ureter cancer 2C92 Urothelium 4.84E-01 1.58E-02 1.06E-01
Uterine cancer 2C78 Endometrium tissue 6.89E-05 -1.53E-01 -5.36E-01
Vitiligo ED63.0 Skin 3.67E-01 -1.11E-01 -3.12E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Mutation analysis of the zinc transporter gene SLC30A4 reveals no association with periodic catatonia on chromosome 15q15. J Neural Transm (Vienna). 2003 Nov;110(11):1329-32.