Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT2I79L)

DTP Name Zinc transporter 9 (SLC30A9)
Gene Name SLC30A9
UniProt ID
Q6PML9 (ZNT9_HUMAN)
VARIDT ID
DTD0277
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms BILAPES; C4orf1; GAC63; HuEL; Human embryonic lung protein; SLC30A9; Solute carrier family 30 member 9; ZNT9; ZnT-9
DTP Family Cation Diffusion Facilitator (CDF) Family ;
Tissue Specificity Ubiquitously expressed in fetal and adulttissues and cancer cell lines.
Sequence
MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGT
LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQVRVKAVLKKRE
YGSKYTQNNFITGVRAINEFCLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEV
WGSPEALAREKKLRKEAEIEYRERLFRNQKILREYRDFLGNTKPRSRTASVFFKGPGKVV
MVAICINGLNCFFKFLAWIYTGSASMFSEAIHSLSDTCNQGLLALGISKSVQTPDPSHPY
GFSNMRYISSLISGVGIFMMGAGLSWYHGVMGLLHPQPIESLLWAYCILAGSLVSEGATL
LVAVNELRRNARAKGMSFYKYVMESRDPSTNVILLEDTAAVLGVIIAATCMGLTSITGNP
LYDSLGSLGVGTLLGMVSAFLIYTNTEALLGRSIQPEQVQRLTELLENDPSVRAIHDVKA
TDLGLGKVRFKAEVDFDGRVVTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENIID
TLGAEVDRLEKELKKRNPEVRHVDLEIL
Function This transporter acts as a zinc transporter involved in intracellular zinc homeostasis.
Endogenous Substrate(s) Zn2+
TCDB ID
2.A.4.6.1
Gene ID
10463

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Zinc salts DMZ4R3Q Arthritis FA20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.20E-08 3.67E-01 8.31E-01
Adrenocortical carcinoma 2D11.Z Kidney 8.65E-01 -9.13E-02 -1.92E-01
Alopecia ED70 Skin from scalp 8.12E-01 -2.06E-02 -8.75E-02
Alzheimer's disease 8A20 Entorhinal cortex 5.37E-06 -2.77E-01 -8.52E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.34E-01 -7.00E-02 -2.77E-01
Aortic stenosis BB70 Calcified aortic valve 8.52E-01 -1.88E-01 -2.07E-01
Apnea 7A40 Hyperplastic tonsil 3.22E-01 -3.17E-01 -4.86E-01
Arthropathy FA00-FA5Z Peripheral blood 4.63E-01 -2.22E-02 -7.56E-02
Asthma CA23 Nasal and bronchial airway 1.14E-05 4.58E-01 7.38E-01
Atopic dermatitis EA80 Skin 9.15E-01 7.68E-02 4.05E-01
Autism 6A02 Whole blood 3.71E-01 4.43E-02 1.50E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.68E-01 -1.11E-01 -3.96E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.18E-01 -4.03E-01 -1.18E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.22E-08 -3.11E-01 -9.77E-01
Batten disease 5C56.1 Whole blood 4.46E-01 -2.54E-01 -1.03E+00
Behcet's disease 4A62 Peripheral blood 9.27E-01 -8.94E-02 -2.85E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.61E-01 1.99E-03 8.49E-03
Bladder cancer 2C94 Bladder tissue 1.69E-01 -3.11E-01 -1.15E+00
Breast cancer 2C60-2C6Z Breast tissue 2.54E-34 6.35E-01 9.79E-01
Cardioembolic stroke 8B11.20 Whole blood 4.30E-01 -6.30E-02 -1.58E-01
Cervical cancer 2C77 Cervical tissue 2.60E-03 -2.52E-01 -5.30E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.70E-01 -1.23E-01 -2.08E-01
Chronic hepatitis C 1E51.1 Whole blood 4.89E-01 -2.16E-02 -9.35E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 7.51E-02 -1.92E-01 -5.58E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.41E-02 -1.01E-01 -3.33E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.50E-01 -9.88E-02 -3.02E-01
Colon cancer 2B90 Colon tissue 4.12E-05 -1.93E-01 -4.97E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.18E-01 1.49E-01 3.67E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.64E-01 7.19E-01 9.49E-01
Endometriosis GA10 Endometrium tissue 3.70E-01 -2.05E-01 -3.23E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.76E-01 -1.39E-02 -3.90E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.29E-07 9.77E-01 1.87E+00
Gastric cancer 2B72 Gastric tissue 4.07E-01 7.00E-02 6.09E-02
Glioblastopma 2A00.00 Nervous tissue 8.47E-09 1.72E-01 3.04E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.49E-01 -2.86E-02 -6.01E-02
Head and neck cancer 2D42 Head and neck tissue 2.81E-02 -9.52E-02 -2.19E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.45E-01 -1.96E-01 -5.78E-01
Huntington's disease 8A01.10 Whole blood 1.77E-02 -1.68E-01 -1.13E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.12E-01 -6.89E-02 -1.98E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.20E-01 -7.47E-02 -2.90E-01
Influenza 1.00E+30 Whole blood 2.96E-04 -2.15E+00 -2.83E+01
Interstitial cystitis GC00.3 Bladder tissue 1.33E-02 -2.70E-01 -1.66E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.42E-01 2.66E-01 6.93E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.49E-01 1.10E-02 4.10E-02
Ischemic stroke 8B11 Peripheral blood 2.78E-01 -2.02E-01 -8.20E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.94E-03 1.80E-01 2.56E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.55E-01 -3.52E-02 -6.45E-02
Lateral sclerosis 8B60.4 Skin 8.11E-01 6.21E-02 2.20E-01
Liver cancer 2C12.0 Liver tissue 3.14E-03 2.69E-01 6.65E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.33E-01 -4.22E-01 -1.04E+00
Lung cancer 2C25 Lung tissue 1.71E-32 4.24E-01 1.36E+00
Lupus erythematosus 4A40 Whole blood 3.68E-03 4.30E-01 4.55E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.23E-01 -6.17E-02 -1.22E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.90E-01 5.69E-02 2.78E-01
Melanoma 2C30 Skin 7.12E-02 -2.91E-01 -4.43E-01
Multiple myeloma 2A83.1 Bone marrow 2.09E-07 8.66E-01 5.01E+00
Multiple myeloma 2A83.1 Peripheral blood 6.69E-01 1.02E-01 3.27E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.15E-01 1.63E-01 6.70E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.82E-01 1.13E-01 3.33E-01
Myelofibrosis 2A20.2 Whole blood 7.18E-01 -1.24E-01 -4.37E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.21E-01 8.13E-02 7.17E-02
Myopathy 8C70.6 Muscle tissue 9.03E-01 -1.56E-01 -4.08E-01
Neonatal sepsis KA60 Whole blood 1.31E-03 2.07E-01 5.39E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.96E-08 1.86E+00 4.50E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.04E-03 2.47E-01 1.49E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.15E-01 6.50E-02 3.73E-01
Olive pollen allergy CA08.00 Peripheral blood 1.64E-01 -5.17E-01 -1.12E+00
Oral cancer 2B6E Oral tissue 1.20E-01 2.59E-01 2.76E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.02E-01 2.54E-01 5.79E-01
Osteoporosis FB83.1 Bone marrow 1.17E-02 -6.86E-01 -2.04E+00
Ovarian cancer 2C73 Ovarian tissue 1.17E-04 1.32E+00 2.55E+00
Pancreatic cancer 2C10 Pancreas 8.19E-03 1.72E-01 4.67E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.17E-01 -3.62E-01 -8.25E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.78E-01 5.28E-02 4.47E-01
Pituitary cancer 2D12 Pituitary tissue 9.51E-01 -1.01E-01 -2.06E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.99E-01 -3.64E-02 -1.30E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.25E-01 1.46E-01 4.78E-01
Polycythemia vera 2A20.4 Whole blood 7.71E-02 -1.06E-01 -3.67E-01
Pompe disease 5C51.3 Biceps muscle 3.99E-01 -2.62E-02 -1.26E-01
Preterm birth KA21.4Z Myometrium 7.19E-01 4.33E-02 1.12E-01
Prostate cancer 2C82 Prostate 1.46E-06 1.25E+00 1.68E+00
Psoriasis EA90 Skin 2.21E-28 6.98E-01 1.70E+00
Rectal cancer 2B92 Rectal colon tissue 2.55E-02 -1.45E-01 -1.13E+00
Renal cancer 2C90-2C91 Kidney 5.18E-01 9.08E-02 1.74E-01
Retinoblastoma 2D02.2 Uvea 4.01E-03 4.46E-01 1.34E+00
Rheumatoid arthritis FA20 Synovial tissue 6.79E-02 -5.58E-01 -1.26E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.18E-01 4.23E-02 2.12E-01
Schizophrenia 6A20 Prefrontal cortex 2.98E-02 -4.02E-01 -6.72E-01
Schizophrenia 6A20 Superior temporal cortex 8.70E-01 1.07E-01 3.89E-01
Scleroderma 4A42.Z Whole blood 2.34E-07 3.19E-01 2.41E+00
Seizure 8A60-8A6Z Whole blood 2.29E-01 1.48E-01 3.69E-01
Sensitive skin EK0Z Skin 6.59E-01 -1.17E-01 -7.40E-01
Sepsis with septic shock 1G41 Whole blood 4.86E-01 -5.90E-02 -1.65E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.47E-01 -3.36E-01 -7.26E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.00E-01 -5.27E-02 -2.30E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.35E-01 -1.52E-01 -1.60E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.97E-03 2.04E-01 2.31E+00
Skin cancer 2C30-2C3Z Skin 9.37E-33 8.29E-01 1.46E+00
Thrombocythemia 3B63 Whole blood 1.05E-01 -8.96E-02 -3.01E-01
Thrombocytopenia 3B64 Whole blood 9.89E-01 1.80E-01 1.25E-01
Thyroid cancer 2D10 Thyroid 8.03E-08 -2.97E-01 -9.65E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.24E-01 -1.03E-01 -2.63E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.08E-03 -6.27E-01 -4.88E+00
Type 2 diabetes 5A11 Liver tissue 1.82E-01 4.09E-01 7.23E-01
Ureter cancer 2C92 Urothelium 8.38E-01 -1.54E-02 -7.67E-02
Uterine cancer 2C78 Endometrium tissue 4.69E-06 3.89E-01 5.72E-01
Vitiligo ED63.0 Skin 7.25E-01 1.16E-01 3.97E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 SLC30A9 mutation affecting intracellular zinc homeostasis causes a novel cerebro-renal syndrome. Brain. 2017 Apr 1;140(4):928-939.