Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT39AOM)

DTP Name Monocarboxylate transporter 3 (SLC16A8)
Gene Name SLC16A8
UniProt ID
O95907 (MOT3_HUMAN)
VARIDT ID
DTD0112
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms MCT 3; MCT3; REMP; SLC16A8; Solute carrier family 16 member 8
DTP Family Major Facilitator Superfamily (MFS)
Monocarboxylate Transporter (MCT) Family
Tissue Specificity Retinal pigment epithelium.
Sequence
MGAGGPRRGEGPPDGGWGWVVLGACFVVTGFAYGFPKAVSVFFRALMRDFDAGYSDTAWV
SSIMLAMLYGTGPVSSILVTRFGCRPVMLAGGLLASAGMILASFATRLLELYLTAGVLTG
LGLALNFQPSLIMLGLYFERRRPLANGLAAAGSPVFLSALSPLGQQLLERFGWRGGFLLL
GGLLLHCCACGAVMRPPPGPGPRPRRDSAGDRAGDAPGEAEADGAGLQLREASPRVRPRR
RLLDLAVCTDRAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
VARPACGALAGLARLRPHVPYLFSLALLANGLTDLSSARARSYGALVAFCVAFGLSYGMV
GALQFEVLMAAVGAPRFPSALGLVLLVEAAAVLIGPPSAGRLVDVLKNYEIIFYLAGSEV
ALAGVFMAVATNCCLRCAKAAPSGPGTEGGASDTEDAEAEGDSEPLPVVAEEPGNLEALE
VLSARGEPTEPEIEARPRLAAESV
Function
This proton-linked transporter mediates the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Endogenous Substrate(s) Lactate
TCDB ID
2.A.1.13.9
Gene ID
23539
Reactome Pathway
Proton-coupled monocarboxylate transport (R-HSA-433692 )
Pyruvate metabolism (R-HSA-70268 )
Basigin interactions (R-HSA-210991 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phenylacetic acid DMQ95GE Hepatic encephalopathy DB99.5 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.55E-01 4.63E-02 2.09E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.55E-01 3.04E-02 1.04E-01
Alopecia ED70 Skin from scalp 2.86E-02 -1.27E-01 -3.24E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.12E-04 -1.04E-01 -5.68E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.05E-01 -1.99E-02 -8.59E-02
Aortic stenosis BB70 Calcified aortic valve 9.20E-01 1.17E-01 1.89E-01
Apnea 7A40 Hyperplastic tonsil 1.32E-01 9.89E-02 3.78E-01
Arthropathy FA00-FA5Z Peripheral blood 8.58E-01 2.31E-02 1.91E-01
Asthma CA23 Nasal and bronchial airway 2.93E-01 -4.22E-02 -1.09E-01
Atopic dermatitis EA80 Skin 1.22E-04 1.47E-01 9.66E-01
Autism 6A02 Whole blood 7.25E-01 -3.65E-03 -1.27E-02
Autoimmune uveitis 9A96 Peripheral monocyte 8.70E-01 2.05E-03 1.68E-02
Autosomal dominant monocytopenia 4B04 Whole blood 6.89E-01 -9.96E-02 -9.48E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.45E-01 -5.88E-02 -2.46E-01
Batten disease 5C56.1 Whole blood 1.63E-01 2.03E-01 1.57E+00
Behcet's disease 4A62 Peripheral blood 1.35E-01 2.35E-02 1.65E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.47E-01 -9.41E-03 -5.46E-02
Bladder cancer 2C94 Bladder tissue 1.33E-04 3.08E-01 2.38E+00
Breast cancer 2C60-2C6Z Breast tissue 1.06E-03 -9.84E-02 -4.01E-01
Cardioembolic stroke 8B11.20 Whole blood 2.11E-02 1.58E-01 7.45E-01
Cervical cancer 2C77 Cervical tissue 5.16E-02 3.54E-01 6.85E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.74E-01 7.67E-02 2.44E-01
Chronic hepatitis C 1E51.1 Whole blood 3.75E-01 1.40E-02 6.81E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 9.17E-01 -2.76E-02 -1.21E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.35E-02 1.15E-01 5.15E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.14E-01 -6.80E-02 -3.09E-01
Colon cancer 2B90 Colon tissue 4.18E-01 -2.18E-02 -7.67E-02
Coronary artery disease BA80-BA8Z Peripheral blood 3.15E-01 1.57E-01 7.30E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.28E-01 -1.31E-01 -5.12E-01
Endometriosis GA10 Endometrium tissue 4.48E-01 -2.31E-03 -1.12E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.21E-01 -5.22E-02 -3.22E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.54E-02 -1.84E-01 -8.22E-01
Gastric cancer 2B72 Gastric tissue 6.09E-01 -2.26E-01 -6.73E-01
Glioblastopma 2A00.00 Nervous tissue 9.37E-44 -2.37E-01 -8.64E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.41E-06 -1.08E+00 -3.25E+00
Head and neck cancer 2D42 Head and neck tissue 1.94E-02 1.88E-02 8.75E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.05E-01 1.16E-01 3.76E-01
Huntington's disease 8A01.10 Whole blood 6.03E-02 1.07E-01 9.73E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.12E-01 1.36E-02 1.02E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.79E-01 1.45E-02 9.89E-02
Influenza 1.00E+30 Whole blood 5.49E-01 -5.24E-02 -1.31E-01
Interstitial cystitis GC00.3 Bladder tissue 9.73E-01 2.42E-02 8.15E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.62E-01 1.85E-01 8.86E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.19E-01 1.45E-02 7.63E-02
Ischemic stroke 8B11 Peripheral blood 1.23E-01 8.15E-02 7.43E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.13E-01 -6.17E-02 -2.32E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.15E-01 -1.85E-01 -4.03E-01
Lateral sclerosis 8B60.4 Skin 9.94E-01 1.27E-01 6.50E-01
Liver cancer 2C12.0 Liver tissue 2.11E-05 -2.12E-01 -6.80E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.16E-01 -9.80E-02 -3.13E-01
Lung cancer 2C25 Lung tissue 6.82E-01 -2.63E-02 -1.07E-01
Lupus erythematosus 4A40 Whole blood 1.68E-02 -1.29E-01 -3.29E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.04E-01 4.39E-02 1.56E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.02E-01 3.29E-02 2.20E-01
Melanoma 2C30 Skin 7.13E-01 -5.71E-02 -1.62E-01
Multiple myeloma 2A83.1 Bone marrow 1.95E-01 -5.61E-02 -3.71E-01
Multiple myeloma 2A83.1 Peripheral blood 1.28E-01 -7.56E-04 -3.63E-03
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.04E-01 2.49E-01 5.95E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.05E-01 5.35E-02 2.40E-01
Myelofibrosis 2A20.2 Whole blood 7.42E-01 -2.25E-02 -2.55E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.85E-01 7.67E-02 3.05E-01
Myopathy 8C70.6 Muscle tissue 1.19E-01 -7.40E-02 -3.87E-01
Neonatal sepsis KA60 Whole blood 8.48E-01 -1.07E-02 -3.12E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.37E-03 -2.60E-01 -8.58E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.36E-01 -2.32E-01 -8.62E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.83E-03 2.51E-01 1.80E+00
Olive pollen allergy CA08.00 Peripheral blood 1.78E-01 2.08E-01 1.13E+00
Oral cancer 2B6E Oral tissue 1.13E-07 -3.71E-01 -1.37E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.43E-01 -1.01E-01 -3.55E-01
Osteoporosis FB83.1 Bone marrow 8.25E-02 5.16E-01 1.57E+00
Ovarian cancer 2C73 Ovarian tissue 3.32E-02 -2.93E-01 -1.06E+00
Pancreatic cancer 2C10 Pancreas 4.19E-04 -2.61E-01 -8.46E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.16E-03 -2.55E-01 -1.64E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.82E-01 -4.56E-03 -2.09E-02
Pituitary cancer 2D12 Pituitary tissue 7.61E-01 -4.38E-04 -1.31E-03
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.25E-01 -2.08E-01 -5.82E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.35E-01 4.32E-02 9.69E-02
Polycythemia vera 2A20.4 Whole blood 3.34E-02 -6.09E-02 -5.78E-01
Pompe disease 5C51.3 Biceps muscle 4.28E-01 6.82E-02 3.59E-01
Preterm birth KA21.4Z Myometrium 4.72E-01 3.76E-02 3.19E-01
Prostate cancer 2C82 Prostate 6.28E-01 1.81E-02 4.36E-02
Psoriasis EA90 Skin 2.86E-01 -5.72E-03 -1.97E-02
Rectal cancer 2B92 Rectal colon tissue 1.80E-01 -1.05E-01 -3.89E-01
Renal cancer 2C90-2C91 Kidney 6.15E-01 -2.33E-02 -1.16E-01
Retinoblastoma 2D02.2 Uvea 6.65E-02 1.34E-01 7.95E-01
Rheumatoid arthritis FA20 Synovial tissue 4.69E-01 -3.06E-02 -6.61E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.39E-01 -7.22E-02 -4.59E-01
Schizophrenia 6A20 Prefrontal cortex 9.76E-01 -9.46E-03 -3.93E-02
Schizophrenia 6A20 Superior temporal cortex 5.91E-02 -3.65E-02 -3.07E-01
Scleroderma 4A42.Z Whole blood 1.00E+00 4.17E-02 2.28E-01
Seizure 8A60-8A6Z Whole blood 4.08E-01 -1.39E-01 -7.20E-01
Sensitive skin EK0Z Skin 1.58E-01 2.97E-02 1.77E-01
Sepsis with septic shock 1G41 Whole blood 5.44E-01 -2.62E-02 -8.20E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.82E-01 2.89E-01 9.02E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.31E-01 6.37E-02 1.86E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.41E-01 1.33E-01 8.00E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.84E-01 -3.84E-01 -1.07E+00
Skin cancer 2C30-2C3Z Skin 8.08E-01 -3.19E-02 -1.09E-01
Thrombocythemia 3B63 Whole blood 4.10E-01 -9.36E-02 -9.46E-01
Thrombocytopenia 3B64 Whole blood 3.17E-01 -1.21E-02 -2.86E-02
Thyroid cancer 2D10 Thyroid 3.17E-06 1.45E-01 5.27E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.33E-05 -2.61E-01 -1.60E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.81E-01 3.05E-02 1.10E-01
Type 2 diabetes 5A11 Liver tissue 2.38E-01 -1.49E-01 -3.91E-01
Ureter cancer 2C92 Urothelium 5.90E-01 3.54E-02 1.43E-01
Uterine cancer 2C78 Endometrium tissue 3.86E-07 -2.03E-01 -6.78E-01
Vitiligo ED63.0 Skin 5.28E-02 -1.25E-01 -1.06E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Immunohistochemical and functional characterization of peptide, organic cation, neutral and basic amino acid, and monocarboxylate drug transporters in human ocular tissues. Drug Metab Dispos. 2013 Feb;41(2):466-74.